BLASTX nr result
ID: Atractylodes22_contig00041329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041329 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511170.1| conserved hypothetical protein [Ricinus comm... 69 4e-10 ref|XP_002318735.1| predicted protein [Populus trichocarpa] gi|2... 69 4e-10 ref|XP_002280267.2| PREDICTED: uncharacterized protein LOC100247... 69 5e-10 emb|CAN73867.1| hypothetical protein VITISV_001273 [Vitis vinifera] 69 5e-10 ref|XP_003602802.1| Nodulin-like protein [Medicago truncatula] g... 64 1e-08 >ref|XP_002511170.1| conserved hypothetical protein [Ricinus communis] gi|223550285|gb|EEF51772.1| conserved hypothetical protein [Ricinus communis] Length = 589 Score = 68.9 bits (167), Expect = 4e-10 Identities = 28/41 (68%), Positives = 37/41 (90%) Frame = -3 Query: 330 CYGTICYSITCGILSGLCLIAVFLSMTVVYRTKRVYAQLYG 208 C G+ICYS+TCGI+SGLC++A+ LS+ VV+RT+ VYAQLYG Sbjct: 545 CVGSICYSLTCGIMSGLCIVAMILSLIVVHRTRSVYAQLYG 585 >ref|XP_002318735.1| predicted protein [Populus trichocarpa] gi|222859408|gb|EEE96955.1| predicted protein [Populus trichocarpa] Length = 591 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/42 (73%), Positives = 35/42 (83%) Frame = -3 Query: 330 CYGTICYSITCGILSGLCLIAVFLSMTVVYRTKRVYAQLYGN 205 C G CYS+TCGI+SGLC+IAV LS+ VV RTK VYAQLYGN Sbjct: 547 CVGLECYSLTCGIMSGLCIIAVILSLIVVRRTKSVYAQLYGN 588 >ref|XP_002280267.2| PREDICTED: uncharacterized protein LOC100247479 [Vitis vinifera] gi|297734441|emb|CBI15688.3| unnamed protein product [Vitis vinifera] Length = 588 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 330 CYGTICYSITCGILSGLCLIAVFLSMTVVYRTKRVYAQLYG 208 C G ICYSITCG++SGLCL+AV LS+ VV+RTK VYA LYG Sbjct: 544 CEGYICYSITCGVMSGLCLVAVVLSLIVVHRTKSVYANLYG 584 >emb|CAN73867.1| hypothetical protein VITISV_001273 [Vitis vinifera] Length = 590 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -3 Query: 330 CYGTICYSITCGILSGLCLIAVFLSMTVVYRTKRVYAQLYG 208 C G ICYSITCG++SGLCL+AV LS+ VV+RTK VYA LYG Sbjct: 546 CEGYICYSITCGVMSGLCLVAVVLSLIVVHRTKSVYANLYG 586 >ref|XP_003602802.1| Nodulin-like protein [Medicago truncatula] gi|355491850|gb|AES73053.1| Nodulin-like protein [Medicago truncatula] Length = 564 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -3 Query: 330 CYGTICYSITCGILSGLCLIAVFLSMTVVYRTKRVYAQLYGNPRT 196 C G ICYS+TCGIL+ +CL+A LS+ +V RTKR Y+QLYGN ++ Sbjct: 518 CEGNICYSLTCGILAVVCLVAAGLSLIIVQRTKRFYSQLYGNGKS 562