BLASTX nr result
ID: Atractylodes22_contig00041188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041188 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|2... 84 9e-15 ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 82 5e-14 ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR28... 81 8e-14 emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera] 81 8e-14 gb|ADM76841.1| auxin efflux carrier-like protein, partial [Picea... 80 2e-13 >ref|XP_002306421.1| predicted protein [Populus trichocarpa] gi|222855870|gb|EEE93417.1| predicted protein [Populus trichocarpa] Length = 397 Score = 84.3 bits (207), Expect = 9e-15 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = +3 Query: 3 PAMNIGTMTQLFNVGQEECSVLTMWSYLAAAFALTGWSTVFMWILT 140 PAMNIGTMTQLF+VGQEECSVL +W+YL AA ALT WST+FMWIL+ Sbjct: 352 PAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTAWSTIFMWILS 397 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = +3 Query: 3 PAMNIGTMTQLFNVGQEECSVLTMWSYLAAAFALTGWSTVFMWILT 140 PAMNIGTMTQLF+VGQEECSVL +W+YL AA ALT WST++MWIL+ Sbjct: 361 PAMNIGTMTQLFDVGQEECSVLFLWTYLVAALALTFWSTIYMWILS 406 >ref|XP_002276744.2| PREDICTED: uncharacterized transporter YBR287W-like [Vitis vinifera] gi|296082565|emb|CBI21570.3| unnamed protein product [Vitis vinifera] Length = 421 Score = 81.3 bits (199), Expect = 8e-14 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 3 PAMNIGTMTQLFNVGQEECSVLTMWSYLAAAFALTGWSTVFMWILT 140 PAMNIGTMT+LFNVGQEECSVL +W+YL AA ALT WST++MW+L+ Sbjct: 376 PAMNIGTMTELFNVGQEECSVLFLWTYLFAALALTVWSTIYMWLLS 421 >emb|CAN62432.1| hypothetical protein VITISV_012649 [Vitis vinifera] Length = 436 Score = 81.3 bits (199), Expect = 8e-14 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = +3 Query: 3 PAMNIGTMTQLFNVGQEECSVLTMWSYLAAAFALTGWSTVFMWILT 140 PAMNIGTMT+LFNVGQEECSVL +W+YL AA ALT WST++MW+L+ Sbjct: 391 PAMNIGTMTELFNVGQEECSVLFLWTYLFAALALTVWSTIYMWLLS 436 >gb|ADM76841.1| auxin efflux carrier-like protein, partial [Picea sitchensis] Length = 193 Score = 79.7 bits (195), Expect = 2e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 PAMNIGTMTQLFNVGQEECSVLTMWSYLAAAFALTGWSTVFMWIL 137 PAMNIGTM QLFNVGQ+ECSVL +W+YL AA A+T WSTV+MWIL Sbjct: 147 PAMNIGTMAQLFNVGQQECSVLFLWTYLLAAIAITFWSTVYMWIL 191