BLASTX nr result
ID: Atractylodes22_contig00041105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041105 (718 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301951.1| predicted protein [Populus trichocarpa] gi|2... 63 7e-08 ref|XP_003527526.1| PREDICTED: E3 ubiquitin-protein ligase ATL23... 62 1e-07 ref|XP_002510592.1| ring finger protein, putative [Ricinus commu... 60 6e-07 ref|XP_003523302.1| PREDICTED: E3 ubiquitin-protein ligase ATL23... 59 8e-07 ref|XP_003589558.1| RING finger protein [Medicago truncatula] gi... 59 1e-06 >ref|XP_002301951.1| predicted protein [Populus trichocarpa] gi|222843677|gb|EEE81224.1| predicted protein [Populus trichocarpa] Length = 165 Score = 62.8 bits (151), Expect = 7e-08 Identities = 27/43 (62%), Positives = 30/43 (69%), Gaps = 3/43 (6%) Frame = +3 Query: 183 CNHGFHVQCADTWLSKNPVWPVCWNKLDTNF---FVPPETTPC 302 CNHGFH++CADTWLSK+PV PVC KLD F PE PC Sbjct: 123 CNHGFHLECADTWLSKHPVCPVCRAKLDAQFSSTSASPENNPC 165 >ref|XP_003527526.1| PREDICTED: E3 ubiquitin-protein ligase ATL23-like [Glycine max] Length = 130 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/40 (65%), Positives = 29/40 (72%) Frame = +3 Query: 183 CNHGFHVQCADTWLSKNPVWPVCWNKLDTNFFVPPETTPC 302 CNHGFHVQCADTWLSK+P+ PVC KLD F +PC Sbjct: 93 CNHGFHVQCADTWLSKHPICPVCRTKLDPQIFT--SQSPC 130 >ref|XP_002510592.1| ring finger protein, putative [Ricinus communis] gi|223551293|gb|EEF52779.1| ring finger protein, putative [Ricinus communis] Length = 175 Score = 59.7 bits (143), Expect = 6e-07 Identities = 24/40 (60%), Positives = 28/40 (70%) Frame = +3 Query: 183 CNHGFHVQCADTWLSKNPVWPVCWNKLDTNFFVPPETTPC 302 CNHGFH++CADTWLS + V PVC KLD+ FF PC Sbjct: 136 CNHGFHLECADTWLSNHSVCPVCRAKLDSQFFNASTDNPC 175 >ref|XP_003523302.1| PREDICTED: E3 ubiquitin-protein ligase ATL23-like [Glycine max] Length = 131 Score = 59.3 bits (142), Expect = 8e-07 Identities = 25/40 (62%), Positives = 28/40 (70%) Frame = +3 Query: 183 CNHGFHVQCADTWLSKNPVWPVCWNKLDTNFFVPPETTPC 302 CNHGFHV CADTWLSK+P+ PVC KLD F +PC Sbjct: 94 CNHGFHVHCADTWLSKHPLCPVCRTKLDPQIFT--SQSPC 131 >ref|XP_003589558.1| RING finger protein [Medicago truncatula] gi|355478606|gb|AES59809.1| RING finger protein [Medicago truncatula] Length = 189 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +3 Query: 183 CNHGFHVQCADTWLSKNPVWPVCWNKLDTNFFVP 284 CNH FH++CADTWLSK P+ PVC KLD F+P Sbjct: 90 CNHAFHLECADTWLSKQPICPVCRAKLDPTLFIP 123