BLASTX nr result
ID: Atractylodes22_contig00041070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00041070 (361 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN64494.1| hypothetical protein VITISV_018031 [Vitis vinifera] 137 1e-30 ref|XP_003631308.1| PREDICTED: uncharacterized protein LOC100853... 136 2e-30 emb|CAN66733.1| hypothetical protein VITISV_032667 [Vitis vinifera] 132 4e-29 ref|XP_003635598.1| PREDICTED: uncharacterized protein LOC100854... 129 3e-28 ref|XP_003635624.1| PREDICTED: uncharacterized protein LOC100854... 128 4e-28 >emb|CAN64494.1| hypothetical protein VITISV_018031 [Vitis vinifera] Length = 1295 Score = 137 bits (344), Expect = 1e-30 Identities = 62/119 (52%), Positives = 80/119 (67%) Frame = +2 Query: 2 FRSLNKELYPGSGNLTLLQYIVKLMHIKVLNGWSDKSLNMLLQFERSILPPGHNLPTSYY 181 F ++ELYPG + L ++VKLMHIKVLN WS+KS +MLL+ P G N+P S+Y Sbjct: 142 FSEAHRELYPGCTKFSALSFLVKLMHIKVLNRWSNKSFDMLLELLLDAFPDGANIPKSHY 201 Query: 182 EMKKILMEIGLGYHNIDVCSYDCALFYGEYGNLLACPVCNHPRYKRNKVPFKRMRYFPL 358 + KK+L + GLGY +I C YDCALF+ E CPVCN PRYK K+P K +R+FPL Sbjct: 202 DAKKMLRDFGLGYDSIHACKYDCALFWKENETFHNCPVCNEPRYKNGKIPQKVLRHFPL 260 >ref|XP_003631308.1| PREDICTED: uncharacterized protein LOC100853922 [Vitis vinifera] Length = 464 Score = 136 bits (342), Expect = 2e-30 Identities = 62/119 (52%), Positives = 80/119 (67%) Frame = +2 Query: 2 FRSLNKELYPGSGNLTLLQYIVKLMHIKVLNGWSDKSLNMLLQFERSILPPGHNLPTSYY 181 F ++ELYPG + L ++VKLMHIKVLN WS+KS +MLL+ P G N+P S+Y Sbjct: 142 FSEAHRELYPGCTKFSALSFLVKLMHIKVLNRWSNKSFDMLLELLLDAFPDGANIPKSHY 201 Query: 182 EMKKILMEIGLGYHNIDVCSYDCALFYGEYGNLLACPVCNHPRYKRNKVPFKRMRYFPL 358 + KK+L + GLGY +I C YDCALF+ E CPVCN PRYK K+P K +R+FPL Sbjct: 202 DAKKMLRDFGLGYDSIHACKYDCALFWKENEMFHNCPVCNEPRYKNGKIPQKVLRHFPL 260 >emb|CAN66733.1| hypothetical protein VITISV_032667 [Vitis vinifera] Length = 852 Score = 132 bits (331), Expect = 4e-29 Identities = 64/120 (53%), Positives = 80/120 (66%), Gaps = 5/120 (4%) Frame = +2 Query: 14 NKELYPGSGNLTLLQYIVKLMHIKVLNGWSDKSLNMLLQFERSILPPGHNLPTSYYEMKK 193 NKELYPG + L ++VKLMHIKVLN WSDKS +MLLQ P N+P +YY+ KK Sbjct: 140 NKELYPGCKKFSALTFLVKLMHIKVLNRWSDKSFDMLLQVLVDAFPERSNIPKTYYDAKK 199 Query: 194 ILMEIGLGYHNIDVCSYDCALFYGEYGNLLACPVCNHPRY-----KRNKVPFKRMRYFPL 358 +L ++GLGY +I C YDCALF+ E L CPVC+ PRY K K+P K +R+FPL Sbjct: 200 MLRDLGLGYDSIHACKYDCALFWKENETLDKCPVCDEPRYKFXNGKGKKIPQKVLRHFPL 259 >ref|XP_003635598.1| PREDICTED: uncharacterized protein LOC100854775, partial [Vitis vinifera] Length = 800 Score = 129 bits (323), Expect = 3e-28 Identities = 63/120 (52%), Positives = 79/120 (65%), Gaps = 5/120 (4%) Frame = +2 Query: 14 NKELYPGSGNLTLLQYIVKLMHIKVLNGWSDKSLNMLLQFERSILPPGHNLPTSYYEMKK 193 NKELYPG + L ++VKLMHIKVLN WSDKS +MLLQ P N+P +YY+ KK Sbjct: 140 NKELYPGCKKFSALTFLVKLMHIKVLNRWSDKSFDMLLQVLVDAFPERSNIPKTYYDAKK 199 Query: 194 ILMEIGLGYHNIDVCSYDCALFYGEYGNLLACPVCNHPRY-----KRNKVPFKRMRYFPL 358 +L ++ LGY +I C YDCALF+ E L CPVC+ PRY K K+P K +R+FPL Sbjct: 200 MLRDLRLGYDSIHACKYDCALFWKENETLDKCPVCDEPRYKFCNGKGKKIPQKVLRHFPL 259 >ref|XP_003635624.1| PREDICTED: uncharacterized protein LOC100854285, partial [Vitis vinifera] Length = 532 Score = 128 bits (322), Expect = 4e-28 Identities = 63/120 (52%), Positives = 79/120 (65%), Gaps = 5/120 (4%) Frame = +2 Query: 14 NKELYPGSGNLTLLQYIVKLMHIKVLNGWSDKSLNMLLQFERSILPPGHNLPTSYYEMKK 193 NKELYPG + L ++VKLMHIKVLN WSDKS +MLLQ N+P +YY+ KK Sbjct: 88 NKELYPGCKKFSALTFLVKLMHIKVLNRWSDKSFDMLLQVLVDAFLERSNIPKTYYDAKK 147 Query: 194 ILMEIGLGYHNIDVCSYDCALFYGEYGNLLACPVCNHPRY-----KRNKVPFKRMRYFPL 358 +L ++GLGY +I C YDCALF+ E L CPVC+ PRY K K+P K +R+FPL Sbjct: 148 MLRDLGLGYDSIHACKYDCALFWKENETLNKCPVCDEPRYKFCNGKGKKIPQKVLRHFPL 207