BLASTX nr result
ID: Atractylodes22_contig00040972
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040972 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276582.1| PREDICTED: potassium transporter 1-like [Vit... 70 1e-10 gb|AAC49844.1| putative potassium transporter AtKT1p [Arabidopsi... 67 1e-09 ref|NP_180568.1| potassium transporter 1 [Arabidopsis thaliana] ... 67 1e-09 ref|XP_002879248.1| hypothetical protein ARALYDRAFT_481917 [Arab... 67 1e-09 ref|XP_003538306.1| PREDICTED: potassium transporter 1-like [Gly... 64 1e-08 >ref|XP_002276582.1| PREDICTED: potassium transporter 1-like [Vitis vinifera] Length = 716 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -3 Query: 290 AIDVVYSFLSRNCRGTDVVLNVPHTSLLEVGMIYYV 183 AID VY+FLSRNCRG DVVLNVPHTSLLEVGMIYYV Sbjct: 681 AIDFVYAFLSRNCRGPDVVLNVPHTSLLEVGMIYYV 716 >gb|AAC49844.1| putative potassium transporter AtKT1p [Arabidopsis thaliana] Length = 712 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 290 AIDVVYSFLSRNCRGTDVVLNVPHTSLLEVGMIYYV 183 A++VV++F+S NCRGTDVVLNVPHTSLLEVGM+YYV Sbjct: 677 AVNVVFAFMSTNCRGTDVVLNVPHTSLLEVGMVYYV 712 >ref|NP_180568.1| potassium transporter 1 [Arabidopsis thaliana] gi|38502834|sp|O22397.2|POT1_ARATH RecName: Full=Potassium transporter 1; Short=AtKT1; Short=AtKUP1; Short=AtPOT1 gi|2654088|gb|AAB87687.1| potassium transporter [Arabidopsis thaliana] gi|2688979|gb|AAB88901.1| high-affinity potassium transporter [Arabidopsis thaliana] gi|3150413|gb|AAC16965.1| high affinity K+ transporter (AtKUP1/AtKT1p) [Arabidopsis thaliana] gi|20197230|gb|AAM14984.1| high affinity K+ transporter (AtKUP1 AtKT1p) [Arabidopsis thaliana] gi|62320122|dbj|BAD94310.1| high affinity K+ transporter [Arabidopsis thaliana] gi|330253247|gb|AEC08341.1| potassium transporter 1 [Arabidopsis thaliana] Length = 712 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 290 AIDVVYSFLSRNCRGTDVVLNVPHTSLLEVGMIYYV 183 A++VV++F+S NCRGTDVVLNVPHTSLLEVGM+YYV Sbjct: 677 AVNVVFAFMSTNCRGTDVVLNVPHTSLLEVGMVYYV 712 >ref|XP_002879248.1| hypothetical protein ARALYDRAFT_481917 [Arabidopsis lyrata subsp. lyrata] gi|297325087|gb|EFH55507.1| hypothetical protein ARALYDRAFT_481917 [Arabidopsis lyrata subsp. lyrata] Length = 712 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = -3 Query: 290 AIDVVYSFLSRNCRGTDVVLNVPHTSLLEVGMIYYV 183 A++VV++F+S NCRGTDVVLNVPHTSLLEVGM+YYV Sbjct: 677 AVNVVFAFMSTNCRGTDVVLNVPHTSLLEVGMVYYV 712 >ref|XP_003538306.1| PREDICTED: potassium transporter 1-like [Glycine max] Length = 720 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -3 Query: 293 FAIDVVYSFLSRNCRGTDVVLNVPHTSLLEVGMIYYV 183 FAIDVV+ FLS+NCR +D VL+VPHTSLLEVGM YYV Sbjct: 684 FAIDVVFGFLSKNCRESDAVLDVPHTSLLEVGMTYYV 720