BLASTX nr result
ID: Atractylodes22_contig00040944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040944 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812... 55 8e-06 >ref|XP_003533374.1| PREDICTED: uncharacterized protein LOC100812827 [Glycine max] Length = 572 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/52 (51%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -2 Query: 256 GGAGEASPNRQWALRSLTRTEWEERRRKGLCFRCGQQYGPT-HKCPEGKLRV 104 GG + +R +RS+ E+EERR KGLCF+CG +Y PT HKC E LRV Sbjct: 302 GGPRSGTTDRWKGIRSIHNEEFEERRAKGLCFKCGGKYHPTFHKCLERALRV 353