BLASTX nr result
ID: Atractylodes22_contig00040914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040914 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547525.1| PREDICTED: uncharacterized protein LOC100802... 55 4e-06 ref|XP_002443418.1| hypothetical protein SORBIDRAFT_08g019165 [S... 55 4e-06 >ref|XP_003547525.1| PREDICTED: uncharacterized protein LOC100802838 [Glycine max] Length = 966 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/77 (40%), Positives = 43/77 (55%), Gaps = 3/77 (3%) Frame = -3 Query: 352 CPCVFCLNHYSHDVDEVDYHLFSKGIDQNYTTWTKHGEKDESP---RSGSVNVNNGLHTE 182 CPCV CLN VDE+ HL GI NYT W HGE + P +S +V+ ++G H E Sbjct: 39 CPCVKCLNGRRQSVDEIRSHLICYGIIPNYTKWIWHGESADIPTVSQSQAVHEDSGEHIE 98 Query: 181 DFASRQVLQPTSDEHNA 131 + R + Q T ++ +A Sbjct: 99 EMI-RDLGQETFEQAHA 114 >ref|XP_002443418.1| hypothetical protein SORBIDRAFT_08g019165 [Sorghum bicolor] gi|241944111|gb|EES17256.1| hypothetical protein SORBIDRAFT_08g019165 [Sorghum bicolor] Length = 436 Score = 55.5 bits (132), Expect = 4e-06 Identities = 27/55 (49%), Positives = 31/55 (56%) Frame = -3 Query: 361 QIPCPCVFCLNHYSHDVDEVDYHLFSKGIDQNYTTWTKHGEKDESPRSGSVNVNN 197 +I CPC C N + DEV HL GI Q YTTW HGE +SPR V+V N Sbjct: 35 EILCPCKKCKNRLNQSHDEVRTHLRCDGIVQGYTTWVHHGEMYDSPRLAFVDVPN 89