BLASTX nr result
ID: Atractylodes22_contig00040768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040768 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313876.1| predicted protein [Populus trichocarpa] gi|2... 95 7e-18 ref|XP_002518674.1| ribosomal pseudouridine synthase, putative [... 91 1e-16 ref|XP_002282614.1| PREDICTED: RNA pseudourine synthase 4, mitoc... 90 2e-16 tpg|DAA60657.1| TPA: hypothetical protein ZEAMMB73_133926 [Zea m... 89 5e-16 tpg|DAA60656.1| TPA: hypothetical protein ZEAMMB73_133926 [Zea m... 89 5e-16 >ref|XP_002313876.1| predicted protein [Populus trichocarpa] gi|222850284|gb|EEE87831.1| predicted protein [Populus trichocarpa] Length = 324 Score = 94.7 bits (234), Expect = 7e-18 Identities = 45/66 (68%), Positives = 54/66 (81%) Frame = -2 Query: 241 LDLANGSISDKQPNLHLHCKKMVLPDVSSALKRAHISSSDYDFGDIESLKFAAPLPPHMQ 62 LDL +GSIS+K P LHLHCK+MVLPDVS AL+ + SSDYDF + SLKF APLPP+M+ Sbjct: 260 LDLDSGSISEKHPRLHLHCKQMVLPDVSKALQDVQL-SSDYDFSQLASLKFDAPLPPYMK 318 Query: 61 RSWDIL 44 +SWDIL Sbjct: 319 KSWDIL 324 >ref|XP_002518674.1| ribosomal pseudouridine synthase, putative [Ricinus communis] gi|223542055|gb|EEF43599.1| ribosomal pseudouridine synthase, putative [Ricinus communis] Length = 536 Score = 90.5 bits (223), Expect = 1e-16 Identities = 42/66 (63%), Positives = 54/66 (81%) Frame = -2 Query: 241 LDLANGSISDKQPNLHLHCKKMVLPDVSSALKRAHISSSDYDFGDIESLKFAAPLPPHMQ 62 +DL +GSIS+K P LHLHCK+MVLPDVS AL+ +SS+YDF D++S++ APLP +MQ Sbjct: 470 IDLESGSISEKHPRLHLHCKQMVLPDVSQALRGVQ-TSSNYDFSDLKSIELDAPLPSYMQ 528 Query: 61 RSWDIL 44 RSWDIL Sbjct: 529 RSWDIL 534 >ref|XP_002282614.1| PREDICTED: RNA pseudourine synthase 4, mitochondrial [Vitis vinifera] gi|296090438|emb|CBI40257.3| unnamed protein product [Vitis vinifera] Length = 476 Score = 90.1 bits (222), Expect = 2e-16 Identities = 43/66 (65%), Positives = 54/66 (81%) Frame = -2 Query: 241 LDLANGSISDKQPNLHLHCKKMVLPDVSSALKRAHISSSDYDFGDIESLKFAAPLPPHMQ 62 LDL +GSI DKQP+LHLHCK+MVLP+VS AL+ + S++ D ++ESL+F APLP HMQ Sbjct: 410 LDLESGSILDKQPHLHLHCKQMVLPNVSLALQNLQL-SAECDLSELESLEFVAPLPSHMQ 468 Query: 61 RSWDIL 44 RSWDIL Sbjct: 469 RSWDIL 474 >tpg|DAA60657.1| TPA: hypothetical protein ZEAMMB73_133926 [Zea mays] Length = 549 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/66 (56%), Positives = 51/66 (77%) Frame = -2 Query: 241 LDLANGSISDKQPNLHLHCKKMVLPDVSSALKRAHISSSDYDFGDIESLKFAAPLPPHMQ 62 L L GS++++QP LHLHCK+M+LPD+S+A+++ S +D+DF D+E L F APLP HMQ Sbjct: 479 LTLGGGSVAEQQPQLHLHCKQMILPDISAAMQQLRSSDADHDFSDLEKLSFVAPLPLHMQ 538 Query: 61 RSWDIL 44 SW IL Sbjct: 539 LSWKIL 544 >tpg|DAA60656.1| TPA: hypothetical protein ZEAMMB73_133926 [Zea mays] Length = 503 Score = 88.6 bits (218), Expect = 5e-16 Identities = 37/66 (56%), Positives = 51/66 (77%) Frame = -2 Query: 241 LDLANGSISDKQPNLHLHCKKMVLPDVSSALKRAHISSSDYDFGDIESLKFAAPLPPHMQ 62 L L GS++++QP LHLHCK+M+LPD+S+A+++ S +D+DF D+E L F APLP HMQ Sbjct: 433 LTLGGGSVAEQQPQLHLHCKQMILPDISAAMQQLRSSDADHDFSDLEKLSFVAPLPLHMQ 492 Query: 61 RSWDIL 44 SW IL Sbjct: 493 LSWKIL 498