BLASTX nr result
ID: Atractylodes22_contig00040753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040753 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002327802.1| predicted protein [Populus trichocarpa] gi|2... 91 2e-16 ref|XP_002867003.1| hypothetical protein ARALYDRAFT_490975 [Arab... 90 3e-16 dbj|BAH56769.1| AT4G36630 [Arabidopsis thaliana] 90 3e-16 ref|NP_195381.6| Vacuolar sorting protein 39 [Arabidopsis thalia... 90 3e-16 emb|CAB16830.1| hypothetical protein [Arabidopsis thaliana] gi|7... 90 3e-16 >ref|XP_002327802.1| predicted protein [Populus trichocarpa] gi|222836887|gb|EEE75280.1| predicted protein [Populus trichocarpa] Length = 1008 Score = 90.5 bits (223), Expect = 2e-16 Identities = 46/65 (70%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = +3 Query: 402 PQRGKSSSALEGISGYSPEVLLKRLPTDALYEDRAVLLGKMNQHELALSIYVHKV-LLDC 578 P R K SALE ISGY+PE LLKRLP DALYE+RA+LLGKMNQHELALS+YVHK+ + D Sbjct: 705 PTRNKLLSALESISGYNPEALLKRLPADALYEERALLLGKMNQHELALSLYVHKLHVPDL 764 Query: 579 FSSWC 593 S+C Sbjct: 765 ALSYC 769 >ref|XP_002867003.1| hypothetical protein ARALYDRAFT_490975 [Arabidopsis lyrata subsp. lyrata] gi|297312839|gb|EFH43262.1| hypothetical protein ARALYDRAFT_490975 [Arabidopsis lyrata subsp. lyrata] Length = 1000 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 402 PQRGKSSSALEGISGYSPEVLLKRLPTDALYEDRAVLLGKMNQHELALSIYVHKV 566 P+R K SALE ISGYSP+ LLKRLP DALYE+RAV+LGKMNQHELALSIYVHK+ Sbjct: 696 PERKKLLSALESISGYSPQPLLKRLPRDALYEERAVILGKMNQHELALSIYVHKL 750 >dbj|BAH56769.1| AT4G36630 [Arabidopsis thaliana] Length = 563 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 402 PQRGKSSSALEGISGYSPEVLLKRLPTDALYEDRAVLLGKMNQHELALSIYVHKV 566 P+R K SALE ISGYSP+ LLKRLP DALYE+RAV+LGKMNQHELALSIYVHK+ Sbjct: 343 PERKKLLSALESISGYSPQPLLKRLPRDALYEERAVILGKMNQHELALSIYVHKL 397 >ref|NP_195381.6| Vacuolar sorting protein 39 [Arabidopsis thaliana] gi|20466826|gb|AAM20730.1| unknown protein [Arabidopsis thaliana] gi|332661279|gb|AEE86679.1| Vacuolar sorting protein 39 [Arabidopsis thaliana] Length = 1000 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 402 PQRGKSSSALEGISGYSPEVLLKRLPTDALYEDRAVLLGKMNQHELALSIYVHKV 566 P+R K SALE ISGYSP+ LLKRLP DALYE+RAV+LGKMNQHELALSIYVHK+ Sbjct: 696 PERKKLLSALESISGYSPQPLLKRLPRDALYEERAVILGKMNQHELALSIYVHKL 750 >emb|CAB16830.1| hypothetical protein [Arabidopsis thaliana] gi|7270611|emb|CAB80329.1| hypothetical protein [Arabidopsis thaliana] Length = 1003 Score = 90.1 bits (222), Expect = 3e-16 Identities = 44/55 (80%), Positives = 49/55 (89%) Frame = +3 Query: 402 PQRGKSSSALEGISGYSPEVLLKRLPTDALYEDRAVLLGKMNQHELALSIYVHKV 566 P+R K SALE ISGYSP+ LLKRLP DALYE+RAV+LGKMNQHELALSIYVHK+ Sbjct: 699 PERKKLLSALESISGYSPQPLLKRLPRDALYEERAVILGKMNQHELALSIYVHKL 753