BLASTX nr result
ID: Atractylodes22_contig00040617
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040617 (554 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI16479.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002283361.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >emb|CBI16479.3| unnamed protein product [Vitis vinifera] Length = 430 Score = 62.0 bits (149), Expect = 6e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +3 Query: 231 NLMKLLPKIEPDIGAIYVLSATVSSVSDYWRDVDDMRVSMNGKGLKKVSGCSVV 392 NL +LL +IEPD+GA YVL++ VSS+S W + D+RVSM KGLKKV G S V Sbjct: 302 NLRRLLLEIEPDLGANYVLASGVSSLSGCWNEAADLRVSMKEKGLKKVPGWSRV 355 >ref|XP_002283361.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36730 [Vitis vinifera] Length = 461 Score = 62.0 bits (149), Expect = 6e-08 Identities = 32/54 (59%), Positives = 40/54 (74%) Frame = +3 Query: 231 NLMKLLPKIEPDIGAIYVLSATVSSVSDYWRDVDDMRVSMNGKGLKKVSGCSVV 392 NL +LL +IEPD+GA YVL++ VSS+S W + D+RVSM KGLKKV G S V Sbjct: 392 NLRRLLLEIEPDLGANYVLASGVSSLSGCWNEAADLRVSMKEKGLKKVPGWSRV 445