BLASTX nr result
ID: Atractylodes22_contig00040505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040505 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptas... 64 1e-08 ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808... 55 5e-06 >gb|ABN06064.1| RNA-directed DNA polymerase (Reverse transcriptase); Chromo; Zinc finger, CCHC-type; Peptidase aspartic, active site; Polynucleotidyl transferase, Ribonuclease H fold [Medicago truncatula] Length = 1297 Score = 64.3 bits (155), Expect = 1e-08 Identities = 24/51 (47%), Positives = 37/51 (72%) Frame = -3 Query: 154 ERGSNDKNRGIKHLPYGELMDRKARGLCFRCGERYHPLHQCSKRQFRMVIL 2 ++ S ++R HL Y ELM+RK +GLCF+CG +HP+HQC +Q R+++L Sbjct: 86 KKKSGPRDRSFTHLSYNELMERKQKGLCFKCGGPFHPMHQCPDKQLRVLVL 136 >ref|XP_003544054.1| PREDICTED: uncharacterized protein LOC100808652 [Glycine max] Length = 463 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/50 (44%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -3 Query: 148 GSNDKNRGIKHLPYGELMDRKARGLCFRCGERYHP-LHQCSKRQFRMVIL 2 G ++K +G++ + E+ +R+A+GLCF+CG +YHP LH+C +R R++IL Sbjct: 291 GVSEKWKGVRSIRNNEMAERRAKGLCFKCGGKYHPTLHKCPERALRVLIL 340