BLASTX nr result
ID: Atractylodes22_contig00040463
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040463 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 54 1e-13 ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 77 1e-12 gb|AEH95573.1| reverse transcriptase [Blueberry red ringspot virus] 74 9e-12 gb|ADM35034.1| reverse transcriptase [Blueberry red ringspot virus] 74 9e-12 dbj|BAG84123.1| reverse transcriptase [Blueberry red ringspot vi... 72 4e-11 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] gi|75559686|sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|32305282|gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 53.5 bits (127), Expect(2) = 1e-13 Identities = 27/61 (44%), Positives = 39/61 (63%) Frame = +1 Query: 1 AEQGFLKNLAKERKTLQKKISKKVP*KWTPEDTTTVQEIKMKVQCLPALYNPQVQDFLII 180 A++GFLK +AKE K L K+S P W+ D+ V +IK K + L LY P+ +D+LII Sbjct: 450 ADKGFLKEIAKETKNLYPKVSITNPWHWSDLDSKLVNQIKKKCKDLSPLYFPKPEDYLII 509 Query: 181 Q 183 + Sbjct: 510 E 510 Score = 47.4 bits (111), Expect(2) = 1e-13 Identities = 31/84 (36%), Positives = 38/84 (45%) Frame = +3 Query: 168 LFNNTDASSDTWA*CLKAIENGKVLLGPDKDGNKIPKSNPSQAQSIPVLSSEVLKTEKYK 347 L TDAS DTWA CLKA E LL P NK+ + Sbjct: 507 LIIETDASGDTWAGCLKAAE----LLFPKGTKNKVVE----------------------- 539 Query: 348 HELCKYESGTFSQAKQNYSTHKRD 419 LCKY SG FS A+Q Y+ H+++ Sbjct: 540 -RLCKYTSGIFSSAEQKYTVHEKE 562 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] gi|18266821|sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|11322953|emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/67 (58%), Positives = 45/67 (67%) Frame = +1 Query: 1 AEQGFLKNLAKERKTLQKKISKKVP*KWTPEDTTTVQEIKMKVQCLPALYNPQVQDFLII 180 A +GF KNLA ERK LQKKIS K P KW DT VQ IK K+Q LP LYN +QDFLI+ Sbjct: 451 ANEGFFKNLALERKHLQKKISVKNPWKWDTIDTKMVQSIKGKIQSLPKLYNASIQDFLIV 510 Query: 181 QMPRATH 201 + + H Sbjct: 511 ETDASQH 517 >gb|AEH95573.1| reverse transcriptase [Blueberry red ringspot virus] Length = 667 Score = 74.3 bits (181), Expect = 9e-12 Identities = 39/69 (56%), Positives = 48/69 (69%) Frame = +1 Query: 1 AEQGFLKNLAKERKTLQKKISKKVP*KWTPEDTTTVQEIKMKVQCLPALYNPQVQDFLII 180 +E+GF+KN AK RK LQKK+S+KVP KWT DTT VQ +K Q LP LYN + D LII Sbjct: 446 SEKGFIKNFAKYRKELQKKVSEKVPWKWTSYDTTQVQALKALCQRLPKLYNAKESDLLII 505 Query: 181 QMPRATHGH 207 A++GH Sbjct: 506 ATD-ASNGH 513 >gb|ADM35034.1| reverse transcriptase [Blueberry red ringspot virus] Length = 282 Score = 74.3 bits (181), Expect = 9e-12 Identities = 39/69 (56%), Positives = 48/69 (69%) Frame = +1 Query: 1 AEQGFLKNLAKERKTLQKKISKKVP*KWTPEDTTTVQEIKMKVQCLPALYNPQVQDFLII 180 +E+GF+KN AK RK LQKK+S+KVP KWT DTT VQ +K Q LP LYN + D LII Sbjct: 135 SEKGFIKNFAKYRKELQKKVSEKVPWKWTSYDTTQVQALKALCQRLPKLYNAKESDLLII 194 Query: 181 QMPRATHGH 207 A++GH Sbjct: 195 ATD-ASNGH 202 >dbj|BAG84123.1| reverse transcriptase [Blueberry red ringspot virus] Length = 185 Score = 72.4 bits (176), Expect = 4e-11 Identities = 38/69 (55%), Positives = 48/69 (69%) Frame = +1 Query: 1 AEQGFLKNLAKERKTLQKKISKKVP*KWTPEDTTTVQEIKMKVQCLPALYNPQVQDFLII 180 +E+GF+K+ AK RK LQKK+S+KVP KWT DTT VQ +K Q LP LYN + D LII Sbjct: 83 SEKGFIKDFAKYRKELQKKVSEKVPWKWTSYDTTQVQALKALCQQLPKLYNAKESDLLII 142 Query: 181 QMPRATHGH 207 A++GH Sbjct: 143 ATD-ASNGH 150