BLASTX nr result
ID: Atractylodes22_contig00040427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040427 (463 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAQ10678.1| type-B response regulator [Catharanthus roseus] 64 1e-08 ref|XP_003550512.1| PREDICTED: two-component response regulator ... 64 1e-08 ref|XP_003529546.1| PREDICTED: two-component response regulator ... 64 1e-08 gb|AEM23772.1| RRB2 type-b response regulator [Nicotiana tabacum] 64 1e-08 emb|CBL94183.1| putative type-b response regulator (sensor histi... 64 1e-08 >gb|AAQ10678.1| type-B response regulator [Catharanthus roseus] Length = 643 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 117 VMPSDDSNSVVMKGVTHGVCAYLIKPVRIKEWRNIWQHV 1 +M +DDS +VVMKGVTHG C YLIKPVRI+ +NIWQHV Sbjct: 113 MMSADDSKNVVMKGVTHGACDYLIKPVRIEALKNIWQHV 151 >ref|XP_003550512.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 677 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 117 VMPSDDSNSVVMKGVTHGVCAYLIKPVRIKEWRNIWQHV 1 +M +DD SVVMKGVTHG C YLIKPVRI+ +NIWQHV Sbjct: 110 MMSADDGKSVVMKGVTHGACDYLIKPVRIEALKNIWQHV 148 >ref|XP_003529546.1| PREDICTED: two-component response regulator ARR2-like [Glycine max] Length = 679 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 117 VMPSDDSNSVVMKGVTHGVCAYLIKPVRIKEWRNIWQHV 1 +M +DD SVVMKGVTHG C YLIKPVRI+ +NIWQHV Sbjct: 110 MMSADDGKSVVMKGVTHGACDYLIKPVRIEALKNIWQHV 148 >gb|AEM23772.1| RRB2 type-b response regulator [Nicotiana tabacum] Length = 669 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 117 VMPSDDSNSVVMKGVTHGVCAYLIKPVRIKEWRNIWQHV 1 +M +DDS VVMKGVTHG C YLIKPVRI+ +NIWQHV Sbjct: 110 MMSADDSKDVVMKGVTHGACDYLIKPVRIEALKNIWQHV 148 >emb|CBL94183.1| putative type-b response regulator (sensor histidine kinase) [Malus x domestica] Length = 674 Score = 63.9 bits (154), Expect = 1e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 117 VMPSDDSNSVVMKGVTHGVCAYLIKPVRIKEWRNIWQHV 1 +M +DD SVVMKGVTHG C YLIKPVRI+ +NIWQHV Sbjct: 110 MMSADDGQSVVMKGVTHGACDYLIKPVRIEALKNIWQHV 148