BLASTX nr result
ID: Atractylodes22_contig00040351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040351 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272164.1| PREDICTED: uncharacterized protein LOC100258... 55 5e-06 >ref|XP_002272164.1| PREDICTED: uncharacterized protein LOC100258714 [Vitis vinifera] Length = 239 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/50 (48%), Positives = 36/50 (72%) Frame = +1 Query: 1 VRMMARVRFKAGAWWARRGILRVYCPNLSIGVSANSTGGSLVGGSKECMV 150 V++ ARV FK+G W AR L C ++++G+ +N++ GSLVGGS+EC V Sbjct: 188 VKVFARVSFKSGVWKARSRFLSAQCNDIALGLPSNASRGSLVGGSRECRV 237