BLASTX nr result
ID: Atractylodes22_contig00040177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040177 (204 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containi... 82 5e-14 emb|CAN77584.1| hypothetical protein VITISV_034996 [Vitis vinifera] 82 6e-14 ref|XP_002533891.1| pentatricopeptide repeat-containing protein,... 79 4e-13 ref|XP_003529141.1| PREDICTED: pentatricopeptide repeat-containi... 76 2e-12 ref|XP_002322960.1| predicted protein [Populus trichocarpa] gi|2... 76 2e-12 >ref|XP_002278184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060 [Vitis vinifera] Length = 691 Score = 82.0 bits (201), Expect = 5e-14 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = +1 Query: 1 GFQPDIISYNIVLKGLCSCNKRQDAIRYLNDAVAREIVPTAITWNILVKAVL 156 G QPDIISYNI LKGLCSC++ DA+ +LNDAV R ++PTAITWNILV+AVL Sbjct: 634 GPQPDIISYNITLKGLCSCHRISDAVGFLNDAVDRGVLPTAITWNILVRAVL 685 >emb|CAN77584.1| hypothetical protein VITISV_034996 [Vitis vinifera] Length = 913 Score = 81.6 bits (200), Expect = 6e-14 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = +1 Query: 1 GFQPDIISYNIVLKGLCSCNKRQDAIRYLNDAVAREIVPTAITWNILVKAVLHLQPPMQ 177 G QPDIISYNI LKGLCSC++ DA+ +LNDAV R ++PTAITWNILV+ L L+ M+ Sbjct: 609 GLQPDIISYNITLKGLCSCHRISDAVGFLNDAVDRGVLPTAITWNILVQGYLALKGYME 667 >ref|XP_002533891.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223526155|gb|EEF28491.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 701 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/55 (61%), Positives = 45/55 (81%) Frame = +1 Query: 1 GFQPDIISYNIVLKGLCSCNKRQDAIRYLNDAVAREIVPTAITWNILVKAVLHLQ 165 G PDIISYNI +KGLCSC++ DAI +LNDA+ R I+PTA+TWNILV+A ++ + Sbjct: 636 GLHPDIISYNITIKGLCSCSRISDAIEFLNDALNRGILPTAVTWNILVRAAVNFR 690 >ref|XP_003529141.1| PREDICTED: pentatricopeptide repeat-containing protein At3g09060-like [Glycine max] Length = 682 Score = 76.3 bits (186), Expect = 2e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = +1 Query: 7 QPDIISYNIVLKGLCSCNKRQDAIRYLNDAVAREIVPTAITWNILVKAVL 156 QPDIISYNI LKGLCSC + DA+ +L+DA+ R +PTAITWNILV+AV+ Sbjct: 632 QPDIISYNITLKGLCSCGRVTDAVGFLDDALVRGFLPTAITWNILVRAVI 681 >ref|XP_002322960.1| predicted protein [Populus trichocarpa] gi|222867590|gb|EEF04721.1| predicted protein [Populus trichocarpa] Length = 694 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +1 Query: 1 GFQPDIISYNIVLKGLCSCNKRQDAIRYLNDAVAREIVPTAITWNILVKAVLHLQP 168 GFQPDIISYNI LKGLCSC + D I +DA+ I+PT+ITW ILV+AVL L P Sbjct: 634 GFQPDIISYNITLKGLCSCGRISDGIALFDDALKNGILPTSITWYILVRAVLKLGP 689