BLASTX nr result
ID: Atractylodes22_contig00040175
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040175 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270352.2| PREDICTED: uncharacterized protein LOC100259... 76 3e-12 emb|CBI24358.3| unnamed protein product [Vitis vinifera] 76 3e-12 ref|XP_002448931.1| hypothetical protein SORBIDRAFT_05g001830 [S... 75 6e-12 ref|XP_002442707.1| hypothetical protein SORBIDRAFT_08g001620 [S... 72 4e-11 ref|NP_001142328.1| hypothetical protein [Zea mays] gi|194708236... 72 5e-11 >ref|XP_002270352.2| PREDICTED: uncharacterized protein LOC100259925 [Vitis vinifera] Length = 319 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 169 MPPLCWRHHTLIQALQSRGPLKDKEFQSIFFDVTGKSLDSHQQLFNEYLRKINMEL 2 MP L WRHH LIQAL SRGPL + +F +IF VTGK+ +HQQ FN+YL KIN EL Sbjct: 1 MPDLSWRHHALIQALLSRGPLIEDDFHAIFSGVTGKNPGAHQQQFNDYLLKINKEL 56 >emb|CBI24358.3| unnamed protein product [Vitis vinifera] Length = 343 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = -2 Query: 169 MPPLCWRHHTLIQALQSRGPLKDKEFQSIFFDVTGKSLDSHQQLFNEYLRKINMEL 2 MP L WRHH LIQAL SRGPL + +F +IF VTGK+ +HQQ FN+YL KIN EL Sbjct: 1 MPDLSWRHHALIQALLSRGPLIEDDFHAIFSGVTGKNPGAHQQQFNDYLLKINKEL 56 >ref|XP_002448931.1| hypothetical protein SORBIDRAFT_05g001830 [Sorghum bicolor] gi|241934774|gb|EES07919.1| hypothetical protein SORBIDRAFT_05g001830 [Sorghum bicolor] Length = 339 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = -2 Query: 169 MPPLCWRHHTLIQALQSRGPLKDKEFQSIFFDVTGKSLDSHQQLFNEYLRKINMEL 2 M PL WRHHTL+QAL +RGPL D++F+++F V+GK +HQQLFN+ L K+N EL Sbjct: 1 MAPLSWRHHTLLQALLTRGPLSDRDFRAVFAAVSGKKPATHQQLFNDTLLKLNKEL 56 >ref|XP_002442707.1| hypothetical protein SORBIDRAFT_08g001620 [Sorghum bicolor] gi|241943400|gb|EES16545.1| hypothetical protein SORBIDRAFT_08g001620 [Sorghum bicolor] Length = 335 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/56 (57%), Positives = 42/56 (75%) Frame = -2 Query: 169 MPPLCWRHHTLIQALQSRGPLKDKEFQSIFFDVTGKSLDSHQQLFNEYLRKINMEL 2 M PL WRHHTL+QAL RGPL +++F ++F V+GK +HQQLFN+ L KIN +L Sbjct: 1 MAPLSWRHHTLLQALLHRGPLSERDFHAVFAGVSGKDPATHQQLFNDTLLKINKDL 56 >ref|NP_001142328.1| hypothetical protein [Zea mays] gi|194708236|gb|ACF88202.1| unknown [Zea mays] gi|238013158|gb|ACR37614.1| unknown [Zea mays] gi|413915931|gb|AFW55863.1| hypothetical protein ZEAMMB73_568396 [Zea mays] Length = 337 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/56 (57%), Positives = 43/56 (76%) Frame = -2 Query: 169 MPPLCWRHHTLIQALQSRGPLKDKEFQSIFFDVTGKSLDSHQQLFNEYLRKINMEL 2 M PL WRHHTL+Q+L RGPL +++F +IF V+GK+ +HQQLFN+ L KIN +L Sbjct: 1 MAPLSWRHHTLLQSLLHRGPLSERDFHAIFAGVSGKNPATHQQLFNDTLLKINKDL 56