BLASTX nr result
ID: Atractylodes22_contig00040146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040146 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525712.1| double-stranded RNA binding protein, putativ... 56 3e-06 ref|NP_001154686.1| double-stranded-RNA-binding protein 4 [Arabi... 55 8e-06 emb|CAB83130.1| putative protein [Arabidopsis thaliana] 55 8e-06 ref|NP_191839.2| double-stranded-RNA-binding protein 4 [Arabidop... 55 8e-06 gb|AAL67059.1| unknown protein [Arabidopsis thaliana] 55 8e-06 >ref|XP_002525712.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223535012|gb|EEF36695.1| double-stranded RNA binding protein, putative [Ricinus communis] Length = 280 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/61 (44%), Positives = 41/61 (67%) Frame = -2 Query: 184 DDCSYKSVLN*LAQNSGLLPLIYAINTTSPHHTPSFASKMKIAGEWFSGQEARTKRQAEW 5 D+ +YK++L LAQ G Y+ T H P+FAS +++ GE+F+GQ+ RTK+QAE+ Sbjct: 3 DEFAYKNLLQELAQKEGYGLPSYSTVTFGESHKPTFASTVEVKGEFFTGQQTRTKKQAEF 62 Query: 4 N 2 N Sbjct: 63 N 63 >ref|NP_001154686.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|197267565|dbj|BAG69145.1| dsRNA-binding protein [Arabidopsis thaliana] gi|332646874|gb|AEE80395.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] Length = 329 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = -2 Query: 181 DCSYKSVLN*LAQNSGLLPLIYAINTTSPHHTPSFASKMKIAGEWFSGQEARTKRQAE 8 D +YK++L +AQ L YA T+ P H P+F S ++ AG+ FSG+EA+TK+ AE Sbjct: 80 DVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAE 137 >emb|CAB83130.1| putative protein [Arabidopsis thaliana] Length = 345 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = -2 Query: 181 DCSYKSVLN*LAQNSGLLPLIYAINTTSPHHTPSFASKMKIAGEWFSGQEARTKRQAE 8 D +YK++L +AQ L YA T+ P H P+F S ++ AG+ FSG+EA+TK+ AE Sbjct: 70 DVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAE 127 >ref|NP_191839.2| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|42572769|ref|NP_974480.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|75244610|sp|Q8H1D4.1|DRB4_ARATH RecName: Full=Double-stranded RNA-binding protein 4; AltName: Full=dsRNA-binding protein 4; Short=AtDRB4 gi|23297784|gb|AAN13025.1| unknown protein [Arabidopsis thaliana] gi|332646872|gb|AEE80393.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] gi|332646873|gb|AEE80394.1| double-stranded-RNA-binding protein 4 [Arabidopsis thaliana] Length = 355 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = -2 Query: 181 DCSYKSVLN*LAQNSGLLPLIYAINTTSPHHTPSFASKMKIAGEWFSGQEARTKRQAE 8 D +YK++L +AQ L YA T+ P H P+F S ++ AG+ FSG+EA+TK+ AE Sbjct: 80 DVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAE 137 >gb|AAL67059.1| unknown protein [Arabidopsis thaliana] Length = 355 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/58 (44%), Positives = 38/58 (65%) Frame = -2 Query: 181 DCSYKSVLN*LAQNSGLLPLIYAINTTSPHHTPSFASKMKIAGEWFSGQEARTKRQAE 8 D +YK++L +AQ L YA T+ P H P+F S ++ AG+ FSG+EA+TK+ AE Sbjct: 80 DVAYKNLLQEIAQKESSLLPFYATATSGPSHAPTFTSTVEFAGKVFSGEEAKTKKLAE 137