BLASTX nr result
ID: Atractylodes22_contig00040127
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00040127 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002888640.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 121 5e-26 ref|NP_001077789.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 116 2e-24 ref|NP_001077790.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 116 2e-24 ref|NP_176975.2| 2-oxoglutarate (2OG) and Fe(II)-dependent oxyge... 116 2e-24 ref|XP_002527551.1| oxidoreductase, putative [Ricinus communis] ... 115 3e-24 >ref|XP_002888640.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297334481|gb|EFH64899.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 389 Score = 121 bits (304), Expect = 5e-26 Identities = 57/69 (82%), Positives = 62/69 (89%) Frame = +2 Query: 20 MADSEHPRLILHGFLSPDLCKELEFIHKSCSTIGYRQNVFSTTLSHLIATNCPHLILPFI 199 M++ EHPRLILH FLSP CKELEFIHKSCSTIGYR NVFSTTLSHLIATN PHLI+PF+ Sbjct: 1 MSEIEHPRLILHNFLSPAECKELEFIHKSCSTIGYRPNVFSTTLSHLIATNSPHLIIPFV 60 Query: 200 PIREKLKEK 226 IRE+LKEK Sbjct: 61 SIRERLKEK 69 >ref|NP_001077789.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] gi|71905465|gb|AAZ52710.1| expressed protein [Arabidopsis thaliana] gi|332196624|gb|AEE34745.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] Length = 339 Score = 116 bits (290), Expect = 2e-24 Identities = 55/69 (79%), Positives = 60/69 (86%) Frame = +2 Query: 20 MADSEHPRLILHGFLSPDLCKELEFIHKSCSTIGYRQNVFSTTLSHLIATNCPHLILPFI 199 M++ EHPRLILH FLSP CKELE IHKS STIGYR NVFSTTLSHLIATN PHLI+PF+ Sbjct: 1 MSEKEHPRLILHNFLSPAECKELELIHKSSSTIGYRPNVFSTTLSHLIATNSPHLIIPFV 60 Query: 200 PIREKLKEK 226 IRE+LKEK Sbjct: 61 SIRERLKEK 69 >ref|NP_001077790.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] gi|71905463|gb|AAZ52709.1| expressed protein [Arabidopsis thaliana] gi|332196625|gb|AEE34746.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] Length = 369 Score = 116 bits (290), Expect = 2e-24 Identities = 55/69 (79%), Positives = 60/69 (86%) Frame = +2 Query: 20 MADSEHPRLILHGFLSPDLCKELEFIHKSCSTIGYRQNVFSTTLSHLIATNCPHLILPFI 199 M++ EHPRLILH FLSP CKELE IHKS STIGYR NVFSTTLSHLIATN PHLI+PF+ Sbjct: 1 MSEKEHPRLILHNFLSPAECKELELIHKSSSTIGYRPNVFSTTLSHLIATNSPHLIIPFV 60 Query: 200 PIREKLKEK 226 IRE+LKEK Sbjct: 61 SIRERLKEK 69 >ref|NP_176975.2| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] gi|56236062|gb|AAV84487.1| At1g68080 [Arabidopsis thaliana] gi|58531340|gb|AAW78592.1| At1g68080 [Arabidopsis thaliana] gi|60547659|gb|AAX23793.1| hypothetical protein At1g68080 [Arabidopsis thaliana] gi|71905461|gb|AAZ52708.1| expressed protein [Arabidopsis thaliana] gi|332196623|gb|AEE34744.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase domain-containing protein [Arabidopsis thaliana] Length = 389 Score = 116 bits (290), Expect = 2e-24 Identities = 55/69 (79%), Positives = 60/69 (86%) Frame = +2 Query: 20 MADSEHPRLILHGFLSPDLCKELEFIHKSCSTIGYRQNVFSTTLSHLIATNCPHLILPFI 199 M++ EHPRLILH FLSP CKELE IHKS STIGYR NVFSTTLSHLIATN PHLI+PF+ Sbjct: 1 MSEKEHPRLILHNFLSPAECKELELIHKSSSTIGYRPNVFSTTLSHLIATNSPHLIIPFV 60 Query: 200 PIREKLKEK 226 IRE+LKEK Sbjct: 61 SIRERLKEK 69 >ref|XP_002527551.1| oxidoreductase, putative [Ricinus communis] gi|223533101|gb|EEF34860.1| oxidoreductase, putative [Ricinus communis] Length = 397 Score = 115 bits (289), Expect = 3e-24 Identities = 52/65 (80%), Positives = 59/65 (90%) Frame = +2 Query: 32 EHPRLILHGFLSPDLCKELEFIHKSCSTIGYRQNVFSTTLSHLIATNCPHLILPFIPIRE 211 +HPRLILH FLS + CKELEF+HKS ST+GYR NVFSTTLSHLIATNCPH I+PF+PIRE Sbjct: 7 KHPRLILHDFLSLEECKELEFVHKSSSTVGYRPNVFSTTLSHLIATNCPHFIIPFVPIRE 66 Query: 212 KLKEK 226 +LKEK Sbjct: 67 RLKEK 71