BLASTX nr result
ID: Atractylodes22_contig00039953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039953 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269471.1| PREDICTED: pentatricopeptide repeat-containi... 105 5e-21 ref|XP_002518652.1| pentatricopeptide repeat-containing protein,... 88 8e-16 ref|XP_004172163.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|XP_004137089.1| PREDICTED: pentatricopeptide repeat-containi... 87 1e-15 ref|NP_195906.1| pentatricopeptide repeat-containing protein [Ar... 77 1e-12 >ref|XP_002269471.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860 [Vitis vinifera] Length = 811 Score = 105 bits (261), Expect = 5e-21 Identities = 54/91 (59%), Positives = 68/91 (74%), Gaps = 1/91 (1%) Frame = +1 Query: 1 RRIGKHDDPNKGRPWS-SHLSPRGEQIFQTLIDPDFHTFQINENLLKLVDFHGNESEFSS 177 RRIGK D N+G+PWS LSP G++I QTLIDP F+ QI+E LL+L + ES+FS Sbjct: 64 RRIGKSQDANRGKPWSHGRLSPPGQRILQTLIDPTFNLAQIDELLLELFEQQPGESDFSV 123 Query: 178 KSLSLDVLGLVQGLVHYKKFDLALSVFDWVK 270 +SLSLDVLG+V+GL YKK D AL VF+WV+ Sbjct: 124 ESLSLDVLGIVKGLGFYKKCDTALRVFEWVR 154 >ref|XP_002518652.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542033|gb|EEF43577.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 827 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/95 (48%), Positives = 66/95 (69%), Gaps = 5/95 (5%) Frame = +1 Query: 4 RIGKHDDPNKGRPWSSH-LSPRGEQIFQTLIDPDFHTFQINENLLKLVDF-HGNESEFSS 177 RI K DPN+G+PW+SH LS G+Q+ +LIDP F ++++ L +L ++ H E SS Sbjct: 78 RISKARDPNRGKPWASHRLSTLGQQVLDSLIDPCFEGSELDKVLSQLFEYYHKEELSLSS 137 Query: 178 ---KSLSLDVLGLVQGLVHYKKFDLALSVFDWVKE 273 SLS+DVLG+++GL YKK D+A+SVF WV+E Sbjct: 138 GTWNSLSMDVLGIIKGLGFYKKCDMAMSVFSWVRE 172 >ref|XP_004172163.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Cucumis sativus] Length = 831 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/90 (45%), Positives = 66/90 (73%), Gaps = 1/90 (1%) Frame = +1 Query: 4 RIGKHDDPNKGRPWSSH-LSPRGEQIFQTLIDPDFHTFQINENLLKLVDFHGNESEFSSK 180 RIG+ DPN+G+PWS H LS +G++I +L++P+F + ++E LL+L + + F+S Sbjct: 85 RIGRSHDPNRGKPWSHHRLSTQGQRILDSLLNPEFDSSSLDEILLQLFETSSDGLNFTSD 144 Query: 181 SLSLDVLGLVQGLVHYKKFDLALSVFDWVK 270 S+S D+LG+++GLV YKK +LAL VF +V+ Sbjct: 145 SVSFDILGIIKGLVFYKKNELALCVFYFVR 174 >ref|XP_004137089.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02860-like [Cucumis sativus] Length = 831 Score = 87.0 bits (214), Expect = 1e-15 Identities = 41/90 (45%), Positives = 66/90 (73%), Gaps = 1/90 (1%) Frame = +1 Query: 4 RIGKHDDPNKGRPWSSH-LSPRGEQIFQTLIDPDFHTFQINENLLKLVDFHGNESEFSSK 180 RIG+ DPN+G+PWS H LS +G++I +L++P+F + ++E LL+L + + F+S Sbjct: 85 RIGRSHDPNRGKPWSHHRLSTQGQRILDSLLNPEFDSSSLDEILLQLFETSSDGLNFTSD 144 Query: 181 SLSLDVLGLVQGLVHYKKFDLALSVFDWVK 270 S+S D+LG+++GLV YKK +LAL VF +V+ Sbjct: 145 SVSFDILGIIKGLVFYKKNELALCVFYFVR 174 >ref|NP_195906.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75181167|sp|Q9LYZ9.1|PP362_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g02860 gi|7413561|emb|CAB86040.1| putative protein [Arabidopsis thaliana] gi|332003145|gb|AED90528.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 819 Score = 77.0 bits (188), Expect = 1e-12 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 1/88 (1%) Frame = +1 Query: 4 RIGKHDDPNKGRPWSSH-LSPRGEQIFQTLIDPDFHTFQINENLLKLVDFHGNESEFSSK 180 RIGK DPN G+PWS H LSP+G+Q+ ++LI+P+F + Q++ L +L + ++ E Sbjct: 77 RIGKSRDPNLGKPWSYHGLSPQGQQVLRSLIEPNFDSGQLDSVLSELFEPFKDKPE---- 132 Query: 181 SLSLDVLGLVQGLVHYKKFDLALSVFDW 264 S S ++L ++GL +KKFDLAL FDW Sbjct: 133 STSSELLAFLKGLGFHKKFDLALRAFDW 160