BLASTX nr result
ID: Atractylodes22_contig00039843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039843 (727 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159267.1| PREDICTED: exocyst complex component 7-like ... 69 4e-17 ref|XP_002309247.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-16 ref|XP_002268110.1| PREDICTED: exocyst complex component 7 [Viti... 69 9e-16 emb|CBI25018.3| unnamed protein product [Vitis vinifera] 69 9e-16 ref|XP_002322790.1| predicted protein [Populus trichocarpa] gi|2... 65 9e-16 >ref|XP_004159267.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus] Length = 190 Score = 68.6 bits (166), Expect(2) = 4e-17 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = -2 Query: 546 GGDGTSTAGMSRAMIKERFKTFNSQFEELHQKKSQWTVPE 427 GG G +++G+SRAM+K+RFKTFN QFEELHQ++SQWTVP+ Sbjct: 85 GGSGDASSGLSRAMVKDRFKTFNIQFEELHQRQSQWTVPD 124 Score = 45.4 bits (106), Expect(2) = 4e-17 Identities = 19/22 (86%), Positives = 21/22 (95%) Frame = -3 Query: 707 IHRRVVQQHANQYKRIYWSKVL 642 IHRRVVQQHANQYKRI W+K+L Sbjct: 52 IHRRVVQQHANQYKRISWAKIL 73 >ref|XP_002309247.1| predicted protein [Populus trichocarpa] gi|222855223|gb|EEE92770.1| predicted protein [Populus trichocarpa] Length = 644 Score = 65.9 bits (159), Expect(2) = 3e-16 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -2 Query: 546 GGDGTSTAGMSRAMIKERFKTFNSQFEELHQKKSQWTVPE 427 G DG S +G+SRAM+K+RFKTFN+QFEELHQ++SQWTVP+ Sbjct: 541 GADG-SASGISRAMVKDRFKTFNAQFEELHQRQSQWTVPD 579 Score = 45.1 bits (105), Expect(2) = 3e-16 Identities = 18/22 (81%), Positives = 21/22 (95%) Frame = -3 Query: 707 IHRRVVQQHANQYKRIYWSKVL 642 IHRR+VQQHANQYKRI W+K+L Sbjct: 503 IHRRIVQQHANQYKRISWAKIL 524 >ref|XP_002268110.1| PREDICTED: exocyst complex component 7 [Vitis vinifera] Length = 650 Score = 68.6 bits (166), Expect(2) = 9e-16 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -2 Query: 546 GGDGTSTAGMSRAMIKERFKTFNSQFEELHQKKSQWTVPE 427 G DG +++G+SRAM+K+RFKTFN QFEELHQK+SQWTVP+ Sbjct: 546 GTDGGNSSGVSRAMVKDRFKTFNMQFEELHQKQSQWTVPD 585 Score = 40.8 bits (94), Expect(2) = 9e-16 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 704 HRRVVQQHANQYKRIYWSKVL 642 HRR+VQQHANQYKR W+K+L Sbjct: 508 HRRIVQQHANQYKRNAWAKIL 528 >emb|CBI25018.3| unnamed protein product [Vitis vinifera] Length = 644 Score = 68.6 bits (166), Expect(2) = 9e-16 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = -2 Query: 546 GGDGTSTAGMSRAMIKERFKTFNSQFEELHQKKSQWTVPE 427 G DG +++G+SRAM+K+RFKTFN QFEELHQK+SQWTVP+ Sbjct: 540 GTDGGNSSGVSRAMVKDRFKTFNMQFEELHQKQSQWTVPD 579 Score = 40.8 bits (94), Expect(2) = 9e-16 Identities = 16/21 (76%), Positives = 19/21 (90%) Frame = -3 Query: 704 HRRVVQQHANQYKRIYWSKVL 642 HRR+VQQHANQYKR W+K+L Sbjct: 502 HRRIVQQHANQYKRNAWAKIL 522 >ref|XP_002322790.1| predicted protein [Populus trichocarpa] gi|222867420|gb|EEF04551.1| predicted protein [Populus trichocarpa] Length = 644 Score = 64.7 bits (156), Expect(2) = 9e-16 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -2 Query: 546 GGDGTSTAGMSRAMIKERFKTFNSQFEELHQKKSQWTVPE 427 GGDG S +G+SRA +K+RFKTFN QFEELHQ++SQWTVP+ Sbjct: 541 GGDG-SASGISRAAVKDRFKTFNVQFEELHQRQSQWTVPD 579 Score = 44.7 bits (104), Expect(2) = 9e-16 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -3 Query: 707 IHRRVVQQHANQYKRIYWSKVL 642 IHRR+VQQHANQYKR+ W+K+L Sbjct: 503 IHRRIVQQHANQYKRVSWAKIL 524