BLASTX nr result
ID: Atractylodes22_contig00039759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039759 (543 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514662.1| hypothetical protein RCOM_1469890 [Ricinus c... 59 4e-07 >ref|XP_002514662.1| hypothetical protein RCOM_1469890 [Ricinus communis] gi|223546266|gb|EEF47768.1| hypothetical protein RCOM_1469890 [Ricinus communis] Length = 519 Score = 59.3 bits (142), Expect = 4e-07 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 2/102 (1%) Frame = +1 Query: 241 YSAEPCNTCGDLGDVDAIITCSECKSVHIHLYCMMKFREAAPPFWSCEEC-AQKKLVSPR 417 +S C+ CGD G ++ I+TC +C+ H+YCM P W CE C + ++ S + Sbjct: 8 HSVRTCHVCGDTGFLEKIVTCFQCEITQEHVYCMPVLLLTVPKIWICEVCQSSEEKDSQQ 67 Query: 418 PGVKKHLPEASTPKVSSFVQTSTRVS-GGQNKNASGSRFNFK 540 H P TP S V + T S + SGS NF+ Sbjct: 68 SFTGAHFPRILTPLNSEIVYSDTVKSIAVEFLENSGSLLNFQ 109