BLASTX nr result
ID: Atractylodes22_contig00039592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039592 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 62 4e-08 ref|NP_068729.1| putative reverse transcriptase [Soybean chlorot... 57 2e-06 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] gi|75559686|sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|32305282|gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -2 Query: 130 AEQNYSTHERETLACLRTMKKWRIELLQTKFELRTDSKYLLGF 2 AEQ Y+ HE+ETLA L+TM+KW+ ELL +F LRTDS Y+ GF Sbjct: 552 AEQKYTVHEKETLAALKTMRKWKAELLPKEFTLRTDSSYVTGF 594 >ref|NP_068729.1| putative reverse transcriptase [Soybean chlorotic mottle virus] gi|18266821|sp|P15629.2|POL_SOCMV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|11322953|emb|CAC16945.1| putative reverse transcriptase [Soybean chlorotic mottle virus] Length = 692 Score = 57.0 bits (136), Expect = 2e-06 Identities = 40/116 (34%), Positives = 53/116 (45%) Frame = -2 Query: 349 KIPKSNPLLVQNTPVVSSEVLKTEQYKHELCKYVSGTFSQAEQNYSTXXXXXXXXXXXXX 170 +I K + Q+T V S +K + + LCKYVSGTF+ E Y Sbjct: 560 EIDKCHSASKQDTHVASK--IKKLENELLLCKYVSGTFTDTETRYPIA------------ 605 Query: 169 XXXXXXXXXXXXXAEQNYSTHERETLACLRTMKKWRIELLQTKFELRTDSKYLLGF 2 E E LA ++ ++KWRI+LLQT+F LRTDSKY GF Sbjct: 606 ---------------------ELEVLAGVKVLEKWRIDLLQTRFLLRTDSKYFAGF 640