BLASTX nr result
ID: Atractylodes22_contig00039515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039515 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160885.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 ref|XP_004148164.1| PREDICTED: pentatricopeptide repeat-containi... 69 4e-10 ref|XP_002518060.1| pentatricopeptide repeat-containing protein,... 67 1e-09 ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_002312829.1| predicted protein [Populus trichocarpa] gi|2... 63 3e-08 >ref|XP_004160885.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Cucumis sativus] Length = 693 Score = 68.9 bits (167), Expect = 4e-10 Identities = 38/81 (46%), Positives = 53/81 (65%) Frame = -2 Query: 243 TTPLPLSDHSTAPSFSAVSPCEEGHKSLCFSLAENLIKRGLLSSARRVIQRLIVQSPTII 64 T +PL D T SFS+ S HK+LCFSL E LI+RG A++VIQR++ QS +I Sbjct: 9 TCTVPL-DPPTTSSFSSASE----HKNLCFSLVEQLIRRGFFFQAQQVIQRIVTQSSSIS 63 Query: 63 DEIFVIDFAVVHGVELDLTTY 1 + I +++FA G+ELDL T+ Sbjct: 64 EAISIVNFAAEWGLELDLATH 84 >ref|XP_004148164.1| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Cucumis sativus] Length = 693 Score = 68.9 bits (167), Expect = 4e-10 Identities = 38/81 (46%), Positives = 53/81 (65%) Frame = -2 Query: 243 TTPLPLSDHSTAPSFSAVSPCEEGHKSLCFSLAENLIKRGLLSSARRVIQRLIVQSPTII 64 T +PL D T SFS+ S HK+LCFSL E LI+RG A++VIQR++ QS +I Sbjct: 9 TCTVPL-DPPTTSSFSSASE----HKNLCFSLVEQLIRRGFFFQAQQVIQRIVTQSSSIS 63 Query: 63 DEIFVIDFAVVHGVELDLTTY 1 + I +++FA G+ELDL T+ Sbjct: 64 EAISIVNFAAEWGLELDLATH 84 >ref|XP_002518060.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542656|gb|EEF44193.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 402 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -2 Query: 174 GHKSLCFSLAENLIKRGLLSSARRVIQRLIVQSPTIIDEIFVIDFAVVHGVELDLTTY 1 GHK+LCFSLAENL +RG L+SA+ +IQR++ S T+ D I +DFA G+ L + Y Sbjct: 40 GHKTLCFSLAENLFRRGRLASAQEIIQRIVTDSSTVPDAISTVDFAASRGINLSVGIY 97 >ref|XP_002268526.2| PREDICTED: pentatricopeptide repeat-containing protein At5g62370-like [Vitis vinifera] Length = 1101 Score = 64.7 bits (156), Expect = 7e-09 Identities = 28/63 (44%), Positives = 43/63 (68%) Frame = -2 Query: 189 SPCEEGHKSLCFSLAENLIKRGLLSSARRVIQRLIVQSPTIIDEIFVIDFAVVHGVELDL 10 +P E H LCF+L + LI+RG+LS ++V++R+I QSP++ D I ++FA G+ELD Sbjct: 33 APTTEHHNKLCFTLTDRLIRRGVLSLGQQVVRRMIKQSPSVSDAILAVEFAAARGLELDS 92 Query: 9 TTY 1 Y Sbjct: 93 CGY 95 >ref|XP_002312829.1| predicted protein [Populus trichocarpa] gi|222849237|gb|EEE86784.1| predicted protein [Populus trichocarpa] Length = 734 Score = 62.8 bits (151), Expect = 3e-08 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = -2 Query: 186 PCEEGHKSLCFSLAENLIKRGLLSSARRVIQRLIVQSPTIIDEIFVIDFAVVHGVELDL 10 P H SLC SL +L++RGLLSSA++VIQR I SPT+ D + I+FA GV+L L Sbjct: 32 PISNDHTSLCQSLVHDLLRRGLLSSAQQVIQRFIASSPTVPDALSAIEFASASGVDLGL 90