BLASTX nr result
ID: Atractylodes22_contig00039473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039473 (514 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA33020.1| oleoyl-acyl carrier protein thioesterase [Cartham... 99 5e-19 gb|AAA33019.1| oleoyl-acyl carrier protein thioesterase [Cartham... 96 3e-18 gb|AAB51523.1| acyl-ACP thioesterase [Garcinia mangostana] 96 3e-18 gb|ABX82799.3| acyl-ACP thioesterase [Jatropha curcas] 94 2e-17 gb|ADH03021.1| acyl-ACP thioesterase [Capsicum annuum] 93 3e-17 >gb|AAA33020.1| oleoyl-acyl carrier protein thioesterase [Carthamus tinctorius] gi|445624|prf||1909371A oleoyl acyl carrier protein thioesterase Length = 389 Score = 98.6 bits (244), Expect = 5e-19 Identities = 53/76 (69%), Positives = 56/76 (73%), Gaps = 6/76 (7%) Frame = +3 Query: 3 DYRRECQQDDIVDSLTSHEPLEDAAATS-----NGASASKDGENS-SNFLHLLRSSGDGL 164 DYRRECQ DDIVDSLTS E L D AA S NG+S K E S FLHLLRSSGDGL Sbjct: 314 DYRRECQHDDIVDSLTSSESLLDDAAISKLEGTNGSSVPKKDETDLSRFLHLLRSSGDGL 373 Query: 165 EINRGRTEWRKKPVKR 212 E+NRGRTEWRKKP K+ Sbjct: 374 ELNRGRTEWRKKPAKK 389 >gb|AAA33019.1| oleoyl-acyl carrier protein thioesterase [Carthamus tinctorius] Length = 385 Score = 95.9 bits (237), Expect = 3e-18 Identities = 50/75 (66%), Positives = 57/75 (76%), Gaps = 5/75 (6%) Frame = +3 Query: 3 DYRRECQQDDIVDSLTSHEPLEDAAATS----NGA-SASKDGENSSNFLHLLRSSGDGLE 167 DYRRECQ+DDIVDSLTS EPL +AA NG+ S KD ++ S F+HLLRS+G GLE Sbjct: 311 DYRRECQRDDIVDSLTSREPLGNAAGVKFKEINGSVSPKKDEQDLSRFMHLLRSAGSGLE 370 Query: 168 INRGRTEWRKKPVKR 212 INR RTEWRKKP KR Sbjct: 371 INRCRTEWRKKPAKR 385 >gb|AAB51523.1| acyl-ACP thioesterase [Garcinia mangostana] Length = 352 Score = 95.9 bits (237), Expect = 3e-18 Identities = 48/75 (64%), Positives = 54/75 (72%), Gaps = 6/75 (8%) Frame = +3 Query: 3 DYRRECQQDDIVDSLTSHEPLEDAAA------TSNGASASKDGENSSNFLHLLRSSGDGL 164 DYRRECQ DD+VDSLTS EP EDA A T+ A+ S + NFLHLLR SG+GL Sbjct: 278 DYRRECQHDDVVDSLTSPEPSEDAEAVFNHNGTNGSANVSANDHGCRNFLHLLRLSGNGL 337 Query: 165 EINRGRTEWRKKPVK 209 EINRGRTEWRKKP + Sbjct: 338 EINRGRTEWRKKPTR 352 >gb|ABX82799.3| acyl-ACP thioesterase [Jatropha curcas] Length = 369 Score = 93.6 bits (231), Expect = 2e-17 Identities = 48/71 (67%), Positives = 53/71 (74%), Gaps = 4/71 (5%) Frame = +3 Query: 3 DYRRECQQDDIVDSLTSHEPLEDAA----ATSNGASASKDGENSSNFLHLLRSSGDGLEI 170 DYRRECQ DD+VDSLTS E LE A AT+ A+A ++S NFLHLLR S DGLEI Sbjct: 297 DYRRECQHDDVVDSLTSAESLEGAGLDLHATNGSATAIAGEQDSRNFLHLLRFSSDGLEI 356 Query: 171 NRGRTEWRKKP 203 NRGRTEWRKKP Sbjct: 357 NRGRTEWRKKP 367 >gb|ADH03021.1| acyl-ACP thioesterase [Capsicum annuum] Length = 371 Score = 92.8 bits (229), Expect = 3e-17 Identities = 45/67 (67%), Positives = 51/67 (76%) Frame = +3 Query: 3 DYRRECQQDDIVDSLTSHEPLEDAAATSNGASASKDGENSSNFLHLLRSSGDGLEINRGR 182 DYRRECQQDD+VDSLTS EP+ED A SA+ + + +FLHLLR S DGLEINR R Sbjct: 302 DYRRECQQDDVVDSLTSVEPIEDTDALGANGSATAAKDVNKSFLHLLRLSSDGLEINRCR 361 Query: 183 TEWRKKP 203 TEWRKKP Sbjct: 362 TEWRKKP 368