BLASTX nr result
ID: Atractylodes22_contig00039454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039454 (341 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK80525.1| citrate synthase [Malus baccata] 68 7e-10 gb|ADL62695.1| citrate synthase [Malus xiaojinensis] 65 6e-09 ref|XP_003571200.1| PREDICTED: citrate synthase 4, mitochondrial... 64 1e-08 gb|AAL11504.1|AF367444_1 citrate synthase [Prunus persica] 64 1e-08 gb|ADU20199.1| mitochondrial citrate synthase [Pyrus pyrifolia] 63 2e-08 >gb|AFK80525.1| citrate synthase [Malus baccata] Length = 473 Score = 68.2 bits (165), Expect = 7e-10 Identities = 39/53 (73%), Positives = 40/53 (75%), Gaps = 3/53 (5%) Frame = -2 Query: 280 ALSKVFRYC*TPFVVADYVYKAIDALPVTAHPMTQFTTGVMALQV---FMKLY 131 ALSK R T VV DYVYKAIDALP+TAHPMTQFTTGVMALQV F K Y Sbjct: 143 ALSKELR---TRAVVPDYVYKAIDALPITAHPMTQFTTGVMALQVESEFQKAY 192 >gb|ADL62695.1| citrate synthase [Malus xiaojinensis] Length = 473 Score = 65.1 bits (157), Expect = 6e-09 Identities = 38/53 (71%), Positives = 39/53 (73%), Gaps = 3/53 (5%) Frame = -2 Query: 280 ALSKVFRYC*TPFVVADYVYKAIDALPVTAHPMTQFTTGVMALQV---FMKLY 131 ALSK R T VV YVYKAIDALP+TAHPMTQFTTGVMALQV F K Y Sbjct: 143 ALSKELR---TRAVVPAYVYKAIDALPITAHPMTQFTTGVMALQVDSEFQKAY 192 >ref|XP_003571200.1| PREDICTED: citrate synthase 4, mitochondrial-like [Brachypodium distachyon] Length = 472 Score = 64.3 bits (155), Expect = 1e-08 Identities = 33/39 (84%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = -2 Query: 238 VADYVYKAIDALPVTAHPMTQFTTGVMALQV---FMKLY 131 V DYVYKAIDALPVTAHPMTQFTTGVMALQV F K Y Sbjct: 154 VPDYVYKAIDALPVTAHPMTQFTTGVMALQVDSEFQKAY 192 >gb|AAL11504.1|AF367444_1 citrate synthase [Prunus persica] Length = 473 Score = 63.9 bits (154), Expect = 1e-08 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 3/39 (7%) Frame = -2 Query: 238 VADYVYKAIDALPVTAHPMTQFTTGVMALQV---FMKLY 131 V DYVYKAIDALP+TAHPMTQFTTGVMALQV F K Y Sbjct: 154 VPDYVYKAIDALPITAHPMTQFTTGVMALQVQSEFQKAY 192 >gb|ADU20199.1| mitochondrial citrate synthase [Pyrus pyrifolia] Length = 473 Score = 63.2 bits (152), Expect = 2e-08 Identities = 37/53 (69%), Positives = 39/53 (73%), Gaps = 3/53 (5%) Frame = -2 Query: 280 ALSKVFRYC*TPFVVADYVYKAIDALPVTAHPMTQFTTGVMALQV---FMKLY 131 ALSK R T VV +VYKAIDALP+TAHPMTQFTTGVMALQV F K Y Sbjct: 143 ALSKELR---TRAVVPAHVYKAIDALPITAHPMTQFTTGVMALQVDSEFQKAY 192