BLASTX nr result
ID: Atractylodes22_contig00039406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039406 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63149.1| hypothetical protein VITISV_040802 [Vitis vinifera] 57 2e-06 >emb|CAN63149.1| hypothetical protein VITISV_040802 [Vitis vinifera] Length = 272 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 3 YAEEFLCRKNLKDGAGRLWHFEIPPAVNATEGKGGASFC 119 YAEEFLCRK L GRLWHFEIPPA N + FC Sbjct: 234 YAEEFLCRKYLVGSVGRLWHFEIPPAANLSRASDSTGFC 272