BLASTX nr result
ID: Atractylodes22_contig00039218
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039218 (714 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN77579.1| hypothetical protein VITISV_015345 [Vitis vinifera] 65 5e-20 emb|CBI39695.3| unnamed protein product [Vitis vinifera] 65 5e-20 ref|XP_002275753.2| PREDICTED: uncharacterized protein LOC100263... 65 6e-20 ref|XP_002315099.1| predicted protein [Populus trichocarpa] gi|2... 59 8e-13 ref|XP_002514765.1| conserved hypothetical protein [Ricinus comm... 60 7e-11 >emb|CAN77579.1| hypothetical protein VITISV_015345 [Vitis vinifera] Length = 1494 Score = 65.5 bits (158), Expect(2) = 5e-20 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 430 RKMSAPLSKRSKDRDEDLSLFREMHKRDKDRVVSLLQPVSDEFESN 293 R++ P KDRDEDL LFRE+HKR+K+R+ SLLQPVSDEFE N Sbjct: 7 RRLLCPKPNGHKDRDEDLLLFREIHKREKERIASLLQPVSDEFEPN 52 Score = 58.2 bits (139), Expect(2) = 5e-20 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 230 FRINAGNYPLYGIASAKKGPGFGFLEGSEKNDYDW 126 F N+GNYPLY IASAKKG G+ FL G KNDYDW Sbjct: 49 FEPNSGNYPLYRIASAKKGSGYEFLAGGNKNDYDW 83 >emb|CBI39695.3| unnamed protein product [Vitis vinifera] Length = 394 Score = 65.5 bits (158), Expect(2) = 5e-20 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 430 RKMSAPLSKRSKDRDEDLSLFREMHKRDKDRVVSLLQPVSDEFESN 293 R++ P KDRDEDL LFRE+HKR+K+R+ SLLQPVSDEFE N Sbjct: 7 RRLLCPKPNGHKDRDEDLLLFREIHKREKERIASLLQPVSDEFEPN 52 Score = 58.2 bits (139), Expect(2) = 5e-20 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 230 FRINAGNYPLYGIASAKKGPGFGFLEGSEKNDYDW 126 F N+GNYPLY IASAKKG G+ FL G KNDYDW Sbjct: 49 FEPNSGNYPLYRIASAKKGSGYEFLAGGNKNDYDW 83 >ref|XP_002275753.2| PREDICTED: uncharacterized protein LOC100263061 [Vitis vinifera] Length = 120 Score = 65.5 bits (158), Expect(2) = 6e-20 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = -3 Query: 430 RKMSAPLSKRSKDRDEDLSLFREMHKRDKDRVVSLLQPVSDEFESN 293 R++ P KDRDEDL LFRE+HKR+K+R+ SLLQPVSDEFE N Sbjct: 7 RRLLCPKPNGHKDRDEDLLLFREIHKREKERIASLLQPVSDEFEPN 52 Score = 58.2 bits (139), Expect(2) = 6e-20 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = -2 Query: 230 FRINAGNYPLYGIASAKKGPGFGFLEGSEKNDYDW 126 F N+GNYPLY IASAKKG G+ FL G KNDYDW Sbjct: 49 FEPNSGNYPLYRIASAKKGSGYEFLAGGNKNDYDW 83 >ref|XP_002315099.1| predicted protein [Populus trichocarpa] gi|222864139|gb|EEF01270.1| predicted protein [Populus trichocarpa] Length = 407 Score = 58.9 bits (141), Expect(2) = 8e-13 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 415 PLSKRSKDRDEDLSLFREMHKRDKDRVVSLLQPVSDEFESN 293 P K KDRDEDL LF+E+ +R+KDR+ LLQPVSDEFE N Sbjct: 12 PFIKGRKDRDEDLLLFKELQRREKDRLACLLQPVSDEFEPN 52 Score = 40.4 bits (93), Expect(2) = 8e-13 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = -2 Query: 218 AGNYPLYGIASAKKGPGFGFLEGSEKNDYDW 126 AGN+ LY IAS +KG G+ ++KN+YDW Sbjct: 54 AGNHALYRIASGRKGSGYELFGENDKNEYDW 84 >ref|XP_002514765.1| conserved hypothetical protein [Ricinus communis] gi|223545816|gb|EEF47319.1| conserved hypothetical protein [Ricinus communis] Length = 332 Score = 60.5 bits (145), Expect(2) = 7e-11 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 406 KRSKDRDEDLSLFREMHKRDKDRVVSLLQPVSDEFE 299 K KDRDEDL LF+E+HKR+KDR SLLQPVSDEFE Sbjct: 2 KGRKDRDEDLLLFKELHKREKDRFASLLQPVSDEFE 37 Score = 32.3 bits (72), Expect(2) = 7e-11 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 230 FRINAGNYPLYGIASAKKGPGFGFLEGSEKNDYDW 126 F + GNY + AS K+G G+G +KNDY+W Sbjct: 36 FEPHDGNYRIN--ASGKQGSGYGLFGEVDKNDYNW 68