BLASTX nr result
ID: Atractylodes22_contig00039211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039211 (316 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002264188.2| PREDICTED: putative cyclin-B3-1-like [Vitis ... 63 3e-08 >ref|XP_002264188.2| PREDICTED: putative cyclin-B3-1-like [Vitis vinifera] Length = 673 Score = 62.8 bits (151), Expect = 3e-08 Identities = 41/105 (39%), Positives = 57/105 (54%) Frame = +1 Query: 1 GTNVGSQSEGVDGRQTLGRVGTKDLKVFNGNPRTRLQGQETVGGVTRESSRNYRPPQRKP 180 GTN+ S+G T R K+LK + N T+ +G+E+V R ++R RK Sbjct: 138 GTNI---SQGAGVCNTSKRASAKNLKASSNNQMTKDKGRESVNNAQR-TARLSHVLTRKS 193 Query: 181 LPVLKHVKKADTCDLKKGNLENKVKNKEKYGFSVKPKVGMKVVPQ 315 LPV++ V K D DLK+ N+E + K K F VK K G KV+PQ Sbjct: 194 LPVIRRVNKVDRSDLKE-NVETSEQGKGKSSFLVKTKAGEKVIPQ 237