BLASTX nr result
ID: Atractylodes22_contig00039152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00039152 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146659.1| PREDICTED: 5'-nucleotidase domain-containing... 77 1e-12 ref|XP_002520582.1| cytosolic purine 5-nucleotidase, putative [R... 77 1e-12 ref|XP_002878705.1| hypothetical protein ARALYDRAFT_900875 [Arab... 76 3e-12 ref|NP_179967.3| HAD-superfamily hydrolase, subfamily IG, 5'-nuc... 73 2e-11 gb|AAC63660.1| hypothetical protein [Arabidopsis thaliana] 73 2e-11 >ref|XP_004146659.1| PREDICTED: 5'-nucleotidase domain-containing protein DDB_G0275467-like [Cucumis sativus] gi|449518071|ref|XP_004166067.1| PREDICTED: 5'-nucleotidase domain-containing protein DDB_G0275467-like [Cucumis sativus] Length = 556 Score = 77.4 bits (189), Expect = 1e-12 Identities = 39/77 (50%), Positives = 50/77 (64%), Gaps = 3/77 (3%) Frame = -3 Query: 227 RILEKKNPKSIGINR---LDNIQAYGLGHDCTWAHYSLSSLNLAYVGAKQHLVNEFRYPE 57 R + K NP+ I +N+ LDNIQ YG +D T AHYS + +L Y AK+HLVNE RYPE Sbjct: 91 RAMPKLNPEGIYVNKNLSLDNIQVYGFDYDYTLAHYSANLQSLIYDLAKEHLVNELRYPE 150 Query: 56 GCWIPKYNKSFPTRGWF 6 C KY+ +FP RG + Sbjct: 151 SCMKFKYDPTFPIRGLY 167 >ref|XP_002520582.1| cytosolic purine 5-nucleotidase, putative [Ricinus communis] gi|223540242|gb|EEF41815.1| cytosolic purine 5-nucleotidase, putative [Ricinus communis] Length = 538 Score = 77.0 bits (188), Expect = 1e-12 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -3 Query: 221 LEKKNPKSIGIN---RLDNIQAYGLGHDCTWAHYSLSSLNLAYVGAKQHLVNEFRYPEGC 51 + K NP+ I +N RLD IQ YG +D T AHYS + NL Y AK+H+VNEFRYPE C Sbjct: 75 MPKMNPEGIYVNKNVRLDTIQVYGFDYDYTLAHYSPNLQNLIYDLAKEHMVNEFRYPEIC 134 Query: 50 WIPKYNKSFPTRGWF 6 KY+ +FP RG + Sbjct: 135 MTFKYDPTFPIRGLY 149 >ref|XP_002878705.1| hypothetical protein ARALYDRAFT_900875 [Arabidopsis lyrata subsp. lyrata] gi|297324544|gb|EFH54964.1| hypothetical protein ARALYDRAFT_900875 [Arabidopsis lyrata subsp. lyrata] Length = 553 Score = 75.9 bits (185), Expect = 3e-12 Identities = 39/75 (52%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -3 Query: 221 LEKKNPKSIGIN---RLDNIQAYGLGHDCTWAHYSLSSLNLAYVGAKQHLVNEFRYPEGC 51 + K NP+ I +N RLDNIQ YG +D T AHYS +L Y AKQH+VNEFRYP+ C Sbjct: 91 MPKMNPQGIYVNKNLRLDNIQVYGFDYDYTLAHYSSHLQSLIYDLAKQHMVNEFRYPDVC 150 Query: 50 WIPKYNKSFPTRGWF 6 KY+ +FP RG + Sbjct: 151 IQFKYDPTFPIRGLY 165 >ref|NP_179967.3| HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase [Arabidopsis thaliana] gi|30102542|gb|AAP21189.1| At2g23890 [Arabidopsis thaliana] gi|110735809|dbj|BAE99881.1| hypothetical protein [Arabidopsis thaliana] gi|330252405|gb|AEC07499.1| HAD-superfamily hydrolase, subfamily IG, 5'-nucleotidase [Arabidopsis thaliana] Length = 553 Score = 73.2 bits (178), Expect = 2e-11 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -3 Query: 221 LEKKNPKSIGIN---RLDNIQAYGLGHDCTWAHYSLSSLNLAYVGAKQHLVNEFRYPEGC 51 + K NP+ I +N RLDNIQ YG +D T AHYS +L Y AK+H+VNEFRYP+ C Sbjct: 91 MPKMNPQGIYVNKNLRLDNIQVYGFDYDYTLAHYSSHLQSLIYDLAKKHMVNEFRYPDVC 150 Query: 50 WIPKYNKSFPTRGWF 6 +Y+ +FP RG + Sbjct: 151 TQFEYDPTFPIRGLY 165 >gb|AAC63660.1| hypothetical protein [Arabidopsis thaliana] Length = 546 Score = 73.2 bits (178), Expect = 2e-11 Identities = 37/75 (49%), Positives = 49/75 (65%), Gaps = 3/75 (4%) Frame = -3 Query: 221 LEKKNPKSIGIN---RLDNIQAYGLGHDCTWAHYSLSSLNLAYVGAKQHLVNEFRYPEGC 51 + K NP+ I +N RLDNIQ YG +D T AHYS +L Y AK+H+VNEFRYP+ C Sbjct: 91 MPKMNPQGIYVNKNLRLDNIQVYGFDYDYTLAHYSSHLQSLIYDLAKKHMVNEFRYPDVC 150 Query: 50 WIPKYNKSFPTRGWF 6 +Y+ +FP RG + Sbjct: 151 TQFEYDPTFPIRGLY 165