BLASTX nr result
ID: Atractylodes22_contig00038875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038875 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15662.3| unnamed protein product [Vitis vinifera] 88 8e-16 ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containi... 88 8e-16 emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] 88 8e-16 ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containi... 86 3e-15 ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 >emb|CBI15662.3| unnamed protein product [Vitis vinifera] Length = 657 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -3 Query: 391 TPLHLLQSHRICDDCHLAVKLIAKVTQRVIVVRDGSRFHCFEDGKCSCDDYW 236 TPL ++QSHRIC DCH A+KLIA VT+R IVVRD SRFH F+DG CSC DYW Sbjct: 606 TPLQIVQSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 657 >ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Vitis vinifera] Length = 704 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -3 Query: 391 TPLHLLQSHRICDDCHLAVKLIAKVTQRVIVVRDGSRFHCFEDGKCSCDDYW 236 TPL ++QSHRIC DCH A+KLIA VT+R IVVRD SRFH F+DG CSC DYW Sbjct: 653 TPLQIVQSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] Length = 704 Score = 87.8 bits (216), Expect = 8e-16 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -3 Query: 391 TPLHLLQSHRICDDCHLAVKLIAKVTQRVIVVRDGSRFHCFEDGKCSCDDYW 236 TPL ++QSHRIC DCH A+KLIA VT+R IVVRD SRFH F+DG CSC DYW Sbjct: 653 TPLQIVQSHRICGDCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] gi|449517215|ref|XP_004165641.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Cucumis sativus] Length = 706 Score = 85.9 bits (211), Expect = 3e-15 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -3 Query: 391 TPLHLLQSHRICDDCHLAVKLIAKVTQRVIVVRDGSRFHCFEDGKCSCDDYW 236 TPL ++QSHRIC DCH +KLIA +T+R IV+RD SRFH F DG CSC DYW Sbjct: 655 TPLQIVQSHRICSDCHSVIKLIAMITKREIVIRDASRFHHFRDGSCSCGDYW 706 >ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 690 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/52 (67%), Positives = 38/52 (73%) Frame = -3 Query: 391 TPLHLLQSHRICDDCHLAVKLIAKVTQRVIVVRDGSRFHCFEDGKCSCDDYW 236 TPL + Q HR+C DCH A+K IA VT R IVVRD SRFH F DG CSC DYW Sbjct: 639 TPLQITQGHRVCGDCHSAIKFIAMVTGREIVVRDASRFHHFRDGSCSCGDYW 690