BLASTX nr result
ID: Atractylodes22_contig00038820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038820 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518269.1| PREDICTED: uncharacterized protein LOC100777... 55 5e-06 >ref|XP_003518269.1| PREDICTED: uncharacterized protein LOC100777373 [Glycine max] Length = 3038 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/61 (50%), Positives = 39/61 (63%) Frame = +2 Query: 35 RQQPVILGPAPNQQAFNVQASSESVCEPTDIEATMHTMTLQQSNTNWYMDTSATSHMTAN 214 + +P ILG P QA+N A S PTDIEA MH ++ Q + N+YMDT ATSHM+A Sbjct: 293 QSRPGILGLRP--QAYNAIAPPTSYT-PTDIEAAMHALSFSQPDGNFYMDTGATSHMSAA 349 Query: 215 P 217 P Sbjct: 350 P 350