BLASTX nr result
ID: Atractylodes22_contig00038749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038749 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510090.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002510090.1| conserved hypothetical protein [Ricinus communis] gi|223550791|gb|EEF52277.1| conserved hypothetical protein [Ricinus communis] Length = 246 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/73 (41%), Positives = 46/73 (63%) Frame = -3 Query: 428 ILVFLVFFGRSFAIVCTSLGWYLMPAINTTPENPKRQKKVVKKEHLPKSSEKMITSPKSV 249 IL+FL FFGRS AI+CTS+GWY++P +++ +PK K KK+ + + SE SP++ Sbjct: 176 ILLFLAFFGRSVAILCTSIGWYIVPTLSSKRPSPKLAK---KKQLVRRLSE---ISPRTR 229 Query: 248 FNNEWMNSQPHRR 210 ++ PH R Sbjct: 230 NIDDPKGKSPHGR 242