BLASTX nr result
ID: Atractylodes22_contig00038642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038642 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526445.1| phosphatidylserine decarboxylase, putative [... 62 5e-08 ref|XP_002267948.1| PREDICTED: C2 domain-containing protein C31G... 56 3e-06 emb|CAN62463.1| hypothetical protein VITISV_035914 [Vitis vinifera] 55 5e-06 >ref|XP_002526445.1| phosphatidylserine decarboxylase, putative [Ricinus communis] gi|223534225|gb|EEF35940.1| phosphatidylserine decarboxylase, putative [Ricinus communis] Length = 633 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/40 (67%), Positives = 37/40 (92%) Frame = -1 Query: 230 DEDLLAYSARSIETLVCVGMQLGVSIKKRAELPLPDIKNC 111 DEDLLA SARS+ETLVCVGM+LGV+ ++R+E+ LP+++NC Sbjct: 590 DEDLLANSARSLETLVCVGMKLGVAARRRSEIDLPNLENC 629 >ref|XP_002267948.1| PREDICTED: C2 domain-containing protein C31G5.15-like [Vitis vinifera] Length = 640 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/43 (62%), Positives = 34/43 (79%) Frame = -1 Query: 230 DEDLLAYSARSIETLVCVGMQLGVSIKKRAELPLPDIKNCVLG 102 DEDLL S +S+ETLV VGM+LGVS KKRA LP+++ CV+G Sbjct: 597 DEDLLENSTKSLETLVAVGMKLGVSTKKRAGPELPNLEGCVIG 639 >emb|CAN62463.1| hypothetical protein VITISV_035914 [Vitis vinifera] Length = 201 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/43 (60%), Positives = 34/43 (79%) Frame = -1 Query: 230 DEDLLAYSARSIETLVCVGMQLGVSIKKRAELPLPDIKNCVLG 102 DEDLL S +S+ETLV VGM+LGVS KK+A LP+++NC +G Sbjct: 158 DEDLLENSTKSLETLVAVGMKLGVSTKKQAGPELPNLENCAIG 200