BLASTX nr result
ID: Atractylodes22_contig00038610
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038610 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634223.1| PREDICTED: RNA pseudourine synthase 7-like i... 65 6e-09 emb|CBI15710.3| unnamed protein product [Vitis vinifera] 65 6e-09 ref|XP_004138251.1| PREDICTED: RNA pseudourine synthase 7-like [... 63 3e-08 ref|XP_002511129.1| ribosomal pseudouridine synthase, putative [... 62 4e-08 ref|XP_002321729.1| predicted protein [Populus trichocarpa] gi|2... 62 5e-08 >ref|XP_003634223.1| PREDICTED: RNA pseudourine synthase 7-like isoform 2 [Vitis vinifera] gi|359491114|ref|XP_002280549.2| PREDICTED: RNA pseudourine synthase 7-like isoform 1 [Vitis vinifera] Length = 386 Score = 65.1 bits (157), Expect = 6e-09 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = +2 Query: 14 VHPCGQYRKNTVVGILQAEHDLAPLFRILLFIWQLPSCTTFHLFSGSLF*I*KYLLFLN* 193 VHPCGQYRKNTVVGILQAEH LAPLF Sbjct: 136 VHPCGQYRKNTVVGILQAEHGLAPLF---------------------------------- 161 Query: 194 TKSIYQLDCLVSGLLILARSASQ 262 I++LD LVSGLLILARSAS+ Sbjct: 162 --PIHRLDRLVSGLLILARSASK 182 >emb|CBI15710.3| unnamed protein product [Vitis vinifera] Length = 374 Score = 65.1 bits (157), Expect = 6e-09 Identities = 41/83 (49%), Positives = 44/83 (53%) Frame = +2 Query: 14 VHPCGQYRKNTVVGILQAEHDLAPLFRILLFIWQLPSCTTFHLFSGSLF*I*KYLLFLN* 193 VHPCGQYRKNTVVGILQAEH LAPLF Sbjct: 126 VHPCGQYRKNTVVGILQAEHGLAPLF---------------------------------- 151 Query: 194 TKSIYQLDCLVSGLLILARSASQ 262 I++LD LVSGLLILARSAS+ Sbjct: 152 --PIHRLDRLVSGLLILARSASK 172 >ref|XP_004138251.1| PREDICTED: RNA pseudourine synthase 7-like [Cucumis sativus] gi|449501468|ref|XP_004161375.1| PREDICTED: RNA pseudourine synthase 7-like [Cucumis sativus] Length = 393 Score = 62.8 bits (151), Expect = 3e-08 Identities = 39/83 (46%), Positives = 44/83 (53%) Frame = +2 Query: 14 VHPCGQYRKNTVVGILQAEHDLAPLFRILLFIWQLPSCTTFHLFSGSLF*I*KYLLFLN* 193 VHPCGQYRKNTVVGIL+AEH LAPLF Sbjct: 144 VHPCGQYRKNTVVGILEAEHGLAPLF---------------------------------- 169 Query: 194 TKSIYQLDCLVSGLLILARSASQ 262 I++LD LVSGLLILAR+AS+ Sbjct: 170 --PIHRLDRLVSGLLILARNASK 190 >ref|XP_002511129.1| ribosomal pseudouridine synthase, putative [Ricinus communis] gi|223550244|gb|EEF51731.1| ribosomal pseudouridine synthase, putative [Ricinus communis] Length = 385 Score = 62.4 bits (150), Expect = 4e-08 Identities = 38/81 (46%), Positives = 43/81 (53%) Frame = +2 Query: 14 VHPCGQYRKNTVVGILQAEHDLAPLFRILLFIWQLPSCTTFHLFSGSLF*I*KYLLFLN* 193 VHPCGQYRKNTVVGILQAEH+LAPLF Sbjct: 138 VHPCGQYRKNTVVGILQAEHNLAPLF---------------------------------- 163 Query: 194 TKSIYQLDCLVSGLLILARSA 256 +++LD LVSGLLILAR+A Sbjct: 164 --PVHRLDRLVSGLLILARNA 182 >ref|XP_002321729.1| predicted protein [Populus trichocarpa] gi|222868725|gb|EEF05856.1| predicted protein [Populus trichocarpa] Length = 388 Score = 62.0 bits (149), Expect = 5e-08 Identities = 37/83 (44%), Positives = 44/83 (53%) Frame = +2 Query: 14 VHPCGQYRKNTVVGILQAEHDLAPLFRILLFIWQLPSCTTFHLFSGSLF*I*KYLLFLN* 193 VHPCGQYRKNTVVG+LQAEH LAPLF Sbjct: 141 VHPCGQYRKNTVVGVLQAEHGLAPLF---------------------------------- 166 Query: 194 TKSIYQLDCLVSGLLILARSASQ 262 +++LD LVSGLLILAR+A++ Sbjct: 167 --PVHRLDRLVSGLLILARNATR 187