BLASTX nr result
ID: Atractylodes22_contig00038436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038436 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002881191.1| hypothetical protein ARALYDRAFT_344930 [Arab... 82 3e-14 ref|NP_565728.1| Vacuolar ATPase assembly integral membrane prot... 82 3e-14 ref|XP_002889564.1| hypothetical protein ARALYDRAFT_470584 [Arab... 80 2e-13 ref|NP_172069.1| vacuolar ATPase assembly integral membrane prot... 79 4e-13 ref|XP_003553904.1| PREDICTED: uncharacterized protein LOC100776... 78 8e-13 >ref|XP_002881191.1| hypothetical protein ARALYDRAFT_344930 [Arabidopsis lyrata subsp. lyrata] gi|297327030|gb|EFH57450.1| hypothetical protein ARALYDRAFT_344930 [Arabidopsis lyrata subsp. lyrata] Length = 105 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 154 MAKVIEKFVIASMLMWAVPIAILYAFNNNLLPGSADMSPHSLTLLSGFLAV 2 MA V++KF+IASM MW +PIAILY FNN+LLPGS +SPHSLTLLSGFLAV Sbjct: 1 MAGVMQKFLIASMFMWILPIAILYGFNNDLLPGSTTLSPHSLTLLSGFLAV 51 >ref|NP_565728.1| Vacuolar ATPase assembly integral membrane protein VMA21-like domain [Arabidopsis thaliana] gi|20198067|gb|AAD24847.2| expressed protein [Arabidopsis thaliana] gi|21594831|gb|AAM66048.1| unknown [Arabidopsis thaliana] gi|88011071|gb|ABD38898.1| At2g31710 [Arabidopsis thaliana] gi|330253481|gb|AEC08575.1| Vacuolar ATPase assembly integral membrane protein VMA21-like domain protein [Arabidopsis thaliana] Length = 105 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/51 (76%), Positives = 45/51 (88%) Frame = -1 Query: 154 MAKVIEKFVIASMLMWAVPIAILYAFNNNLLPGSADMSPHSLTLLSGFLAV 2 MA V++KF+IASM MW +PIAILY FNN+LLPGS +SPHSLTLLSGFLAV Sbjct: 1 MAGVMQKFLIASMFMWILPIAILYGFNNDLLPGSTTLSPHSLTLLSGFLAV 51 >ref|XP_002889564.1| hypothetical protein ARALYDRAFT_470584 [Arabidopsis lyrata subsp. lyrata] gi|297335406|gb|EFH65823.1| hypothetical protein ARALYDRAFT_470584 [Arabidopsis lyrata subsp. lyrata] Length = 106 Score = 80.1 bits (196), Expect = 2e-13 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -1 Query: 154 MAKVIEKFVIASMLMWAVPIAILYAFNNNLLPGSADMSPHSLTLLSGFLAV 2 MA V+ KF+IASM MW +P+AILY FN NLLPGS +SPHSLTLLSGFLAV Sbjct: 1 MAGVMHKFLIASMFMWILPVAILYGFNYNLLPGSTTLSPHSLTLLSGFLAV 51 >ref|NP_172069.1| vacuolar ATPase assembly integral membrane protein VMA21-like domain-containing protein [Arabidopsis thaliana] gi|61742516|gb|AAX55079.1| hypothetical protein At1g05780 [Arabidopsis thaliana] gi|332189769|gb|AEE27890.1| vacuolar ATPase assembly integral membrane protein VMA21-like domain-containing protein [Arabidopsis thaliana] Length = 106 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -1 Query: 154 MAKVIEKFVIASMLMWAVPIAILYAFNNNLLPGSADMSPHSLTLLSGFLAV 2 MA V+ KF+IASM MW +P+AILY FN+NLLPGS +SPHSL LLSGFLAV Sbjct: 1 MAGVMHKFLIASMFMWILPVAILYGFNHNLLPGSTTLSPHSLILLSGFLAV 51 >ref|XP_003553904.1| PREDICTED: uncharacterized protein LOC100776528 [Glycine max] Length = 104 Score = 77.8 bits (190), Expect = 8e-13 Identities = 33/48 (68%), Positives = 46/48 (95%) Frame = -1 Query: 145 VIEKFVIASMLMWAVPIAILYAFNNNLLPGSADMSPHSLTLLSGFLAV 2 VI+KF +AS+ MWA+PIAILYAFN+N+LPG++++SP+S+TL+SGFLAV Sbjct: 3 VIQKFFVASLFMWAIPIAILYAFNHNILPGTSNLSPYSMTLVSGFLAV 50