BLASTX nr result
ID: Atractylodes22_contig00038197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038197 (1062 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002333289.1| predicted protein [Populus trichocarpa] gi|2... 61 4e-07 >ref|XP_002333289.1| predicted protein [Populus trichocarpa] gi|222835888|gb|EEE74309.1| predicted protein [Populus trichocarpa] Length = 425 Score = 61.2 bits (147), Expect = 4e-07 Identities = 28/58 (48%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +2 Query: 797 PLSTP--LPVKHLSPAEIPQRRAQGLCFWCTEKFHPGHKCNPPQLLMIEYPDPTPIID 964 P +P +P+K L+ E+ +RR+QG+CF C EKF PGHKC P+LL++E D T + D Sbjct: 267 PTKSPAAMPMKRLAWDEMQKRRSQGICFNCDEKFTPGHKCQKPRLLLLEGDDETSLQD 324