BLASTX nr result
ID: Atractylodes22_contig00038178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00038178 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003618219.1| hypothetical protein MTR_6g006160 [Medicago ... 55 5e-06 >ref|XP_003618219.1| hypothetical protein MTR_6g006160 [Medicago truncatula] gi|355493234|gb|AES74437.1| hypothetical protein MTR_6g006160 [Medicago truncatula] Length = 325 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/67 (38%), Positives = 36/67 (53%) Frame = +1 Query: 97 FKNSFGKKVENGVETLFWKEKWLGEASLDERFPRLWRLEKIKDVLVKDRVSSITGVVNWS 276 + N +++ NG T FWK+KW+G+A L FPRL+ L K+ V D V G W+ Sbjct: 57 YMNKVRRRIGNGRNTSFWKDKWVGDAPLFRTFPRLFSLSNQKEAKVGDVVEIRGGGCVWN 116 Query: 277 *DWSREP 297 W R P Sbjct: 117 TTWRRNP 123