BLASTX nr result
ID: Atractylodes22_contig00037837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037837 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520538.1| PREDICTED: uncharacterized protein LOC100784... 77 1e-12 ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|2... 75 6e-12 ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing pr... 75 7e-12 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 74 1e-11 ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing pr... 74 1e-11 >ref|XP_003520538.1| PREDICTED: uncharacterized protein LOC100784177 [Glycine max] Length = 283 Score = 77.0 bits (188), Expect = 1e-12 Identities = 42/79 (53%), Positives = 49/79 (62%), Gaps = 3/79 (3%) Frame = +3 Query: 3 FLHKYCAELPRTLQHKLHKDHSLDLVDFDDSKSK---TYRCSGCYIDGNTFVYKCEPCKF 173 FLH+ CAELPRT QH HK H L L SK+ Y+C GC GN FVY+C+ C+F Sbjct: 15 FLHQSCAELPRTKQHPFHK-HPLTL----QSKAPYDGIYKCDGCRRLGNGFVYRCDVCQF 69 Query: 174 YLDVNCAFLPNTIKHEFHK 230 LDV CA L I+HE HK Sbjct: 70 DLDVCCASLEERIEHESHK 88 >ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|222872679|gb|EEF09810.1| predicted protein [Populus trichocarpa] Length = 190 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/75 (45%), Positives = 41/75 (54%) Frame = +3 Query: 3 FLHKYCAELPRTLQHKLHKDHSLDLVDFDDSKSKTYRCSGCYIDGNTFVYKCEPCKFYLD 182 FLHK C ELPR L+H H H L L+ + C+ C G +F Y C C+F L Sbjct: 61 FLHKSCFELPRELEHTSHPQHLLVLLSSPPGDDSKFTCNACGDYGTSFAYHCATCQFNLH 120 Query: 183 VNCAFLPNTIKHEFH 227 V CAFLP T+KH H Sbjct: 121 VGCAFLPKTMKHVDH 135 >ref|NP_180394.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|4803954|gb|AAD29826.1| unknown protein [Arabidopsis thaliana] gi|330253004|gb|AEC08098.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 74.7 bits (182), Expect = 7e-12 Identities = 31/76 (40%), Positives = 43/76 (56%) Frame = +3 Query: 3 FLHKYCAELPRTLQHKLHKDHSLDLVDFDDSKSKTYRCSGCYIDGNTFVYKCEPCKFYLD 182 FLHK C +LP + HK H +H L L+ + TY C C G+ F Y C CK+++ Sbjct: 55 FLHKSCFDLPGEIHHKSHTNHPLTLLHSPPNGLSTYTCDACGEYGSAFTYHCSECKYHVH 114 Query: 183 VNCAFLPNTIKHEFHK 230 V CAF+P +K E H+ Sbjct: 115 VGCAFVPENVKREDHE 130 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/75 (41%), Positives = 44/75 (58%) Frame = +3 Query: 3 FLHKYCAELPRTLQHKLHKDHSLDLVDFDDSKSKTYRCSGCYIDGNTFVYKCEPCKFYLD 182 FLHK C +LPR ++HK H DH L L+ + + TY C C G+ F Y C C++ + Sbjct: 260 FLHKSCFDLPREIRHKSHPDHPLILLYSPQNNNSTYTCDACGEYGSGFTYNCSICQYDVH 319 Query: 183 VNCAFLPNTIKHEFH 227 V C +P T+KH+ H Sbjct: 320 VGCVSVPETMKHDEH 334 >ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|25336186|pir||H84555 hypothetical protein At2g17740 [imported] - Arabidopsis thaliana gi|34146812|gb|AAQ62414.1| At2g17740 [Arabidopsis thaliana] gi|51968510|dbj|BAD42947.1| unknown protein [Arabidopsis thaliana] gi|51968940|dbj|BAD43162.1| unknown protein [Arabidopsis thaliana] gi|51971363|dbj|BAD44346.1| unknown protein [Arabidopsis thaliana] gi|51971715|dbj|BAD44522.1| unknown protein [Arabidopsis thaliana] gi|330251583|gb|AEC06677.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 73.9 bits (180), Expect = 1e-11 Identities = 31/75 (41%), Positives = 44/75 (58%) Frame = +3 Query: 3 FLHKYCAELPRTLQHKLHKDHSLDLVDFDDSKSKTYRCSGCYIDGNTFVYKCEPCKFYLD 182 FLHK C +LPR ++HK H DH L L+ + + TY C C G+ F Y C C++ + Sbjct: 51 FLHKSCFDLPREIRHKSHPDHPLILLYSPQNNNSTYTCDACGEYGSGFTYNCSICQYDVH 110 Query: 183 VNCAFLPNTIKHEFH 227 V C +P T+KH+ H Sbjct: 111 VGCVSVPETMKHDEH 125