BLASTX nr result
ID: Atractylodes22_contig00037812
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037812 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272855.1| PREDICTED: ABC transporter B family member 2... 72 4e-11 emb|CAN59888.1| hypothetical protein VITISV_026170 [Vitis vinifera] 72 4e-11 emb|CBI18648.3| unnamed protein product [Vitis vinifera] 70 1e-10 ref|XP_002272060.1| PREDICTED: ABC transporter B family member 2... 70 1e-10 ref|NP_177218.3| ABC transporter B family member 26 [Arabidopsis... 65 7e-09 >ref|XP_002272855.1| PREDICTED: ABC transporter B family member 26, chloroplastic [Vitis vinifera] gi|296087608|emb|CBI34864.3| unnamed protein product [Vitis vinifera] Length = 658 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +2 Query: 2 GSLTFAALSEISIPNLLTASIFAAQNGEALVFYKNLKLLTFLCFASGICRYCKS 163 GSLT AALSEIS+PNL+ AS+F+AQ+GE +VFY+N +LL LC SGIC +S Sbjct: 102 GSLTLAALSEISMPNLIAASVFSAQSGETMVFYRNSQLLILLCILSGICSGLRS 155 >emb|CAN59888.1| hypothetical protein VITISV_026170 [Vitis vinifera] Length = 391 Score = 72.4 bits (176), Expect = 4e-11 Identities = 34/54 (62%), Positives = 43/54 (79%) Frame = +2 Query: 2 GSLTFAALSEISIPNLLTASIFAAQNGEALVFYKNLKLLTFLCFASGICRYCKS 163 GSLT AALSEIS+PNL+ AS+F+AQ+GE +VFY+N +LL LC SGIC +S Sbjct: 102 GSLTLAALSEISMPNLIAASVFSAQSGETMVFYRNSQLLILLCILSGICSGLRS 155 >emb|CBI18648.3| unnamed protein product [Vitis vinifera] Length = 587 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = +2 Query: 5 SLTFAALSEISIPNLLTASIFAAQNGEALVFYKNLKLLTFLCFASGIC 148 +L AA+SEISIP+ LTASIF+AQ+GE +VF++N+ LL FLCFASGIC Sbjct: 32 ALVLAAVSEISIPHFLTASIFSAQSGEIVVFHRNVGLLVFLCFASGIC 79 >ref|XP_002272060.1| PREDICTED: ABC transporter B family member 26, chloroplastic-like [Vitis vinifera] Length = 705 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/48 (68%), Positives = 42/48 (87%) Frame = +2 Query: 5 SLTFAALSEISIPNLLTASIFAAQNGEALVFYKNLKLLTFLCFASGIC 148 +L AA+SEISIP+ LTASIF+AQ+GE +VF++N+ LL FLCFASGIC Sbjct: 150 ALVLAAVSEISIPHFLTASIFSAQSGEIVVFHRNVGLLVFLCFASGIC 197 >ref|NP_177218.3| ABC transporter B family member 26 [Arabidopsis thaliana] gi|75330788|sp|Q8RY46.1|AB26B_ARATH RecName: Full=ABC transporter B family member 26, chloroplastic; Short=ABC transporter ABCB.26; Short=AtABCB26; AltName: Full=Antigen peptide transporter-like 1; AltName: Full=Transporter associated with antigen processing-like protein 1; Short=AtTAP1; Flags: Precursor gi|19335722|gb|AAL85485.1| transporter associated with antigen processing-like protein [Arabidopsis thaliana] gi|110737412|dbj|BAF00650.1| transporter associated with antigen processing-like protein [Arabidopsis thaliana] gi|332196967|gb|AEE35088.1| ABC transporter B family member 26 [Arabidopsis thaliana] Length = 700 Score = 64.7 bits (156), Expect = 7e-09 Identities = 31/57 (54%), Positives = 43/57 (75%) Frame = +2 Query: 5 SLTFAALSEISIPNLLTASIFAAQNGEALVFYKNLKLLTFLCFASGICRYCKSQYWG 175 +L AALSEI+IP+ LTASIF+AQ+G+ VF++N+KLL LC SGIC + ++G Sbjct: 145 TLIVAALSEITIPHFLTASIFSAQSGDIAVFHRNVKLLVTLCVTSGICSGIRGCFFG 201