BLASTX nr result
ID: Atractylodes22_contig00037758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037758 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004149853.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 >ref|XP_004149853.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Cucumis sativus] gi|449520209|ref|XP_004167126.1| PREDICTED: pentatricopeptide repeat-containing protein At5g55740, chloroplastic-like [Cucumis sativus] Length = 840 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +1 Query: 1 KCGNINQARRVFDMRLVKDLPLYNAMISGCALHG 102 KCG+INQA+RVFDM L K+LP+YNAMISG ALHG Sbjct: 601 KCGSINQAKRVFDMILKKELPVYNAMISGYALHG 634