BLASTX nr result
ID: Atractylodes22_contig00037496
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037496 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529781.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002529781.1| conserved hypothetical protein [Ricinus communis] gi|223530725|gb|EEF32595.1| conserved hypothetical protein [Ricinus communis] Length = 294 Score = 54.7 bits (130), Expect = 8e-06 Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = -3 Query: 212 MAAGWVKSLQCKARAV-DVVESXXXXXLPASSSCRKSFQSLKDVVDT 75 MA+GWVKSLQCK+RA+ DV+ L SSSCRK+ QS+KDV++T Sbjct: 1 MASGWVKSLQCKSRAMEDVISPSPKHHLIPSSSCRKTSQSIKDVIET 47