BLASTX nr result
ID: Atractylodes22_contig00037477
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037477 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265075.2| PREDICTED: RING-H2 finger protein ATL46-like... 66 3e-09 emb|CBI32123.3| unnamed protein product [Vitis vinifera] 59 4e-07 emb|CAN61651.1| hypothetical protein VITISV_014602 [Vitis vinifera] 57 2e-06 >ref|XP_002265075.2| PREDICTED: RING-H2 finger protein ATL46-like [Vitis vinifera] Length = 393 Score = 66.2 bits (160), Expect = 3e-09 Identities = 41/78 (52%), Positives = 45/78 (57%), Gaps = 16/78 (20%) Frame = -3 Query: 358 YVVGNSELQVSFWPN----------------GCRTGNRSIDEGRDGKEISNGSKVESFSV 227 YVV NS+LQV+ PN G TGN S D +GK+IS GSK ESFSV Sbjct: 297 YVVANSDLQVALCPNRADAGSDAVVKLMKGRGGHTGNSSTDGDVEGKKISIGSKDESFSV 356 Query: 226 SKIWLWSKKDGGKFQDSS 173 SKIWLW KK GKF SS Sbjct: 357 SKIWLWPKK--GKFPSSS 372 >emb|CBI32123.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/50 (66%), Positives = 35/50 (70%) Frame = -3 Query: 322 WPNGCRTGNRSIDEGRDGKEISNGSKVESFSVSKIWLWSKKDGGKFQDSS 173 WP G TGN S D +GK+IS GSK ESFSVSKIWLW KK GKF SS Sbjct: 91 WPCG-HTGNSSTDGDVEGKKISIGSKDESFSVSKIWLWPKK--GKFPSSS 137 >emb|CAN61651.1| hypothetical protein VITISV_014602 [Vitis vinifera] Length = 326 Score = 56.6 bits (135), Expect = 2e-06 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = -3 Query: 313 GCRTGNRSIDEGRDGKEISNGSKVESFSVSKIWLWSKKDGGKFQDSS 173 G TGN S D +GK+IS GSK ESFSVSKIWLW KK GKF SS Sbjct: 261 GGHTGNSSTDGDVEGKKISIGSKDESFSVSKIWLWPKK--GKFPSSS 305