BLASTX nr result
ID: Atractylodes22_contig00037469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037469 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515332.1| conserved hypothetical protein [Ricinus comm... 81 1e-13 ref|XP_002509827.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 >ref|XP_002515332.1| conserved hypothetical protein [Ricinus communis] gi|223545812|gb|EEF47316.1| conserved hypothetical protein [Ricinus communis] Length = 171 Score = 80.9 bits (198), Expect = 1e-13 Identities = 44/80 (55%), Positives = 54/80 (67%) Frame = -2 Query: 240 MMQTLAELADKMKESESIRTPPRATDFGSNSTRIGPYVPKLEFPKFDGNNPKMWIKKCNR 61 MMQTL E M + +R+P D SN R+G Y+PKL+FPKFDG+N + WIKKC + Sbjct: 1 MMQTLKE---NMLIALEVRSP--RFDERSNQPRLG-YIPKLKFPKFDGSNLRQWIKKCCK 54 Query: 60 YFGLCKVADDQKVDLACLNM 1 YF CK+ D QKVDLA LNM Sbjct: 55 YFVFCKIPDKQKVDLASLNM 74 >ref|XP_002509827.1| conserved hypothetical protein [Ricinus communis] gi|223549726|gb|EEF51214.1| conserved hypothetical protein [Ricinus communis] Length = 208 Score = 61.6 bits (148), Expect = 6e-08 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = -2 Query: 168 TDFGSNSTRIGPYVPKLEFPKFDGNNPKMWIKKCNRYFGLCKVADDQKVDLACL 7 T++ S+ +G +PK+E F+GNNP++WIKKC +YF L + ++QK+D+A L Sbjct: 95 TNWNSSFGSMGGRIPKVELSHFEGNNPRLWIKKCEKYFQLYSIPNEQKIDIASL 148