BLASTX nr result
ID: Atractylodes22_contig00037464
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037464 (201 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529479.1| Transcription factor RF2a, putative [Ricinus... 102 3e-20 ref|XP_002270784.1| PREDICTED: probable transcription factor Pos... 101 7e-20 ref|XP_002327989.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 ref|XP_003546876.1| PREDICTED: probable transcription factor Pos... 94 1e-17 ref|NP_172097.1| putative basic-leucine zipper transcription fac... 94 2e-17 >ref|XP_002529479.1| Transcription factor RF2a, putative [Ricinus communis] gi|223531037|gb|EEF32889.1| Transcription factor RF2a, putative [Ricinus communis] Length = 425 Score = 102 bits (254), Expect = 3e-20 Identities = 52/65 (80%), Positives = 55/65 (84%), Gaps = 2/65 (3%) Frame = -3 Query: 190 GHGS--RHFSHDISTMPDNPPKYLGHRRACSEIVTLLDDISFDSDLGVVGGFNGASYSDE 17 GHGS FSHDIS MPDNPPK LGHRRA SEI+TL DDISFDSDLGVVGG +G S+SDE Sbjct: 55 GHGSDSSRFSHDISRMPDNPPKKLGHRRAHSEILTLPDDISFDSDLGVVGGADGPSFSDE 114 Query: 16 TEEDL 2 TEEDL Sbjct: 115 TEEDL 119 >ref|XP_002270784.1| PREDICTED: probable transcription factor PosF21 [Vitis vinifera] Length = 425 Score = 101 bits (251), Expect = 7e-20 Identities = 51/67 (76%), Positives = 55/67 (82%), Gaps = 4/67 (5%) Frame = -3 Query: 190 GHG----SRHFSHDISTMPDNPPKYLGHRRACSEIVTLLDDISFDSDLGVVGGFNGASYS 23 GHG S FSHDIS MPDNPPK LGHRRA SEI+TL DD+SFDSDLGVVGG +G S+S Sbjct: 55 GHGISPDSNRFSHDISRMPDNPPKNLGHRRAHSEILTLPDDLSFDSDLGVVGGADGPSFS 114 Query: 22 DETEEDL 2 DETEEDL Sbjct: 115 DETEEDL 121 >ref|XP_002327989.1| predicted protein [Populus trichocarpa] gi|222837398|gb|EEE75777.1| predicted protein [Populus trichocarpa] Length = 363 Score = 97.1 bits (240), Expect = 1e-18 Identities = 51/66 (77%), Positives = 55/66 (83%), Gaps = 3/66 (4%) Frame = -3 Query: 190 GHGS--RHFSHDISTMPDNPPKYLGHRRACSEIVTLLDDISFDSDLGVV-GGFNGASYSD 20 GHGS FSHDIS MPDNPPK LGHRRA SEI+TL DDISFDSDLGVV GG +G ++SD Sbjct: 13 GHGSDSNRFSHDISRMPDNPPKNLGHRRAHSEILTLPDDISFDSDLGVVGGGADGPTFSD 72 Query: 19 ETEEDL 2 ETEEDL Sbjct: 73 ETEEDL 78 >ref|XP_003546876.1| PREDICTED: probable transcription factor PosF21-like [Glycine max] Length = 420 Score = 94.0 bits (232), Expect = 1e-17 Identities = 48/67 (71%), Positives = 53/67 (79%), Gaps = 4/67 (5%) Frame = -3 Query: 190 GHG----SRHFSHDISTMPDNPPKYLGHRRACSEIVTLLDDISFDSDLGVVGGFNGASYS 23 GHG S FSHDIS MPDNPP+ GHRRA SEI+TL DDISFDSDLGVVGG +G S+S Sbjct: 57 GHGLSTDSSGFSHDISRMPDNPPRNRGHRRAHSEILTLPDDISFDSDLGVVGGGDGPSFS 116 Query: 22 DETEEDL 2 D+ EEDL Sbjct: 117 DDAEEDL 123 >ref|NP_172097.1| putative basic-leucine zipper transcription factor bZIP69 [Arabidopsis thaliana] gi|8810469|gb|AAF80130.1|AC024174_12 Contains similarity to a b-Zip binding protein from Arabidopsis thaliana gb|Z86093 and contains a b-Zip transcription factor PF|00170 domain. ESTs gb|AV551499, gb|T04752, gb|AV550784, gb|AV550336, gb|AV545846, gb|AV538486, gb|AV542369, gb|AV538179 come from this gene [Arabidopsis thaliana] gi|17065886|emb|CAD12037.1| AtbZIP transcription factor [Arabidopsis thaliana] gi|110739188|dbj|BAF01510.1| bZip transcription factor AtbZip69 [Arabidopsis thaliana] gi|114213515|gb|ABI54340.1| At1g06070 [Arabidopsis thaliana] gi|332189815|gb|AEE27936.1| putative basic-leucine zipper transcription factor bZIP69 [Arabidopsis thaliana] Length = 423 Score = 93.6 bits (231), Expect = 2e-17 Identities = 44/60 (73%), Positives = 51/60 (85%) Frame = -3 Query: 181 SRHFSHDISTMPDNPPKYLGHRRACSEIVTLLDDISFDSDLGVVGGFNGASYSDETEEDL 2 + FSHDIS MPDNPPK LGHRRA SEI+TL DD+SFDSDLGVVG +G S+SD+T+EDL Sbjct: 53 ANRFSHDISRMPDNPPKNLGHRRAHSEILTLPDDLSFDSDLGVVGAADGPSFSDDTDEDL 112