BLASTX nr result
ID: Atractylodes22_contig00037406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037406 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307829.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002307829.1| predicted protein [Populus trichocarpa] gi|222857278|gb|EEE94825.1| predicted protein [Populus trichocarpa] Length = 272 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/79 (34%), Positives = 38/79 (48%), Gaps = 1/79 (1%) Frame = -2 Query: 254 KHPLIQV-VDPNRLCKACNRWSKGISYACEACNFQLDMMCAIRSPQFLAHRYCKGHEIPL 78 +HPL QV V C C + G + C+ C FQL + CA+ P H + + H++ L Sbjct: 43 QHPLSQVEVSDLFTCSGCKEYGSGFRFTCQQCEFQLHVFCALAPPLLKEHPFHRQHQLSL 102 Query: 77 TYPPVKDHPEDFYCDICEK 21 PVK CD+C K Sbjct: 103 HSKPVKGGILKSKCDVCWK 121