BLASTX nr result
ID: Atractylodes22_contig00037340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037340 (510 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509756.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 >ref|XP_002509756.1| conserved hypothetical protein [Ricinus communis] gi|223549655|gb|EEF51143.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 3/82 (3%) Frame = +3 Query: 63 RISIPAIMVLILVIAPVCSCRNIH-RVTMEGNNQRFQQRHHHPNHPWH--TAGPEDSRNN 233 RI+ ++V+IL ++ + SCR++H + ++ ++ P WH PE S + Sbjct: 9 RIAFQLLIVIILAVSHLSSCRHLHTNIGVDDQAKKTPTTLLPPQLVWHFPATSPEASAKD 68 Query: 234 KADQIFGVSQRTIPGGPNPLHN 299 + D ++GVS RT+PGGPNPLHN Sbjct: 69 QIDAVYGVSLRTVPGGPNPLHN 90