BLASTX nr result
ID: Atractylodes22_contig00037281
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037281 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511129.1| ribosomal pseudouridine synthase, putative [... 61 8e-08 ref|XP_003634223.1| PREDICTED: RNA pseudourine synthase 7-like i... 61 1e-07 emb|CBI15710.3| unnamed protein product [Vitis vinifera] 61 1e-07 gb|AFK47408.1| unknown [Medicago truncatula] 60 1e-07 ref|XP_003602781.1| RNA pseudourine synthase [Medicago truncatul... 60 1e-07 >ref|XP_002511129.1| ribosomal pseudouridine synthase, putative [Ricinus communis] gi|223550244|gb|EEF51731.1| ribosomal pseudouridine synthase, putative [Ricinus communis] Length = 385 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -2 Query: 372 VHPRDQYRKNTVVGILQAKHDLAPLFPIHRLD 277 VHP QYRKNTVVGILQA+H+LAPLFP+HRLD Sbjct: 138 VHPCGQYRKNTVVGILQAEHNLAPLFPVHRLD 169 >ref|XP_003634223.1| PREDICTED: RNA pseudourine synthase 7-like isoform 2 [Vitis vinifera] gi|359491114|ref|XP_002280549.2| PREDICTED: RNA pseudourine synthase 7-like isoform 1 [Vitis vinifera] Length = 386 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 372 VHPRDQYRKNTVVGILQAKHDLAPLFPIHRLD 277 VHP QYRKNTVVGILQA+H LAPLFPIHRLD Sbjct: 136 VHPCGQYRKNTVVGILQAEHGLAPLFPIHRLD 167 >emb|CBI15710.3| unnamed protein product [Vitis vinifera] Length = 374 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -2 Query: 372 VHPRDQYRKNTVVGILQAKHDLAPLFPIHRLD 277 VHP QYRKNTVVGILQA+H LAPLFPIHRLD Sbjct: 126 VHPCGQYRKNTVVGILQAEHGLAPLFPIHRLD 157 >gb|AFK47408.1| unknown [Medicago truncatula] Length = 268 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 372 VHPRDQYRKNTVVGILQAKHDLAPLFPIHRLD 277 VHP QYRKNTVVGILQA+H LAPLFP+HRLD Sbjct: 25 VHPCGQYRKNTVVGILQAEHGLAPLFPVHRLD 56 >ref|XP_003602781.1| RNA pseudourine synthase [Medicago truncatula] gi|355491829|gb|AES73032.1| RNA pseudourine synthase [Medicago truncatula] Length = 380 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -2 Query: 372 VHPRDQYRKNTVVGILQAKHDLAPLFPIHRLD 277 VHP QYRKNTVVGILQA+H LAPLFP+HRLD Sbjct: 137 VHPCGQYRKNTVVGILQAEHGLAPLFPVHRLD 168