BLASTX nr result
ID: Atractylodes22_contig00037243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037243 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69872.1| hypothetical protein VITISV_032285 [Vitis vinifera] 67 2e-09 emb|CAN62588.1| hypothetical protein VITISV_028559 [Vitis vinifera] 64 1e-08 emb|CAN70453.1| hypothetical protein VITISV_035056 [Vitis vinifera] 64 2e-08 emb|CAN64407.1| hypothetical protein VITISV_003511 [Vitis vinifera] 62 5e-08 emb|CAN76591.1| hypothetical protein VITISV_020293 [Vitis vinifera] 61 1e-07 >emb|CAN69872.1| hypothetical protein VITISV_032285 [Vitis vinifera] Length = 843 Score = 66.6 bits (161), Expect = 2e-09 Identities = 32/80 (40%), Positives = 50/80 (62%), Gaps = 3/80 (3%) Frame = +1 Query: 1 KKGYKCFYPVTKKLFITMDVTFVESMPFYSKPSL*GENMGESWEYTTSIPN-PIIDHTPH 177 KKGYKC++P +K+ F+TMDV+F E PF+S P L GE E E+ S+P PI++++ Sbjct: 731 KKGYKCYHPASKRFFVTMDVSFNEKQPFFSSPYLQGEPFAEDKEFFPSLPTLPILENSTK 790 Query: 178 SISDART--SVPTTSESNDN 231 ++ + S+ T E+ N Sbjct: 791 TVQTKGSDFSIAVTPENTKN 810 >emb|CAN62588.1| hypothetical protein VITISV_028559 [Vitis vinifera] Length = 874 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = +1 Query: 1 KKGYKCFYPVTKKLFITMDVTFVESMPFYSKPSL*GENMGES--WEYTTSIPNPIIDHTP 174 KKGYKCF P+TK+ + TMDV+F+E++P+++K L GE + E WE +P+ I+D + Sbjct: 259 KKGYKCFNPLTKRFYTTMDVSFIENVPYFTKNLLQGEKLVEPNFWEIVEPLPSVILDISL 318 Query: 175 HSISDARTSVPTTSES 222 + + + PT SES Sbjct: 319 E--KENKETKPTESES 332 >emb|CAN70453.1| hypothetical protein VITISV_035056 [Vitis vinifera] Length = 703 Score = 63.5 bits (153), Expect = 2e-08 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = +1 Query: 1 KKGYKCFYPVTKKLFITMDVTFVESMPFYSKPSL*GENMGES--WEYTTSIPNPIIDHTP 174 KKGYKCF P+TK+ + TMDV+F+E++P+++K L GE + E WE +P+ I+D + Sbjct: 90 KKGYKCFNPLTKRFYTTMDVSFMENVPYFTKNLLQGEKLVEPNFWEIVEPLPSVILDISL 149 Query: 175 HSISDARTSVPTTSES 222 + + + PT SES Sbjct: 150 E--KENKETKPTESES 163 >emb|CAN64407.1| hypothetical protein VITISV_003511 [Vitis vinifera] Length = 1081 Score = 62.0 bits (149), Expect = 5e-08 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (2%) Frame = +1 Query: 1 KKGYKCFYPVTKKLFITMDVTFVESMPFYSKPSL*GENMGES--WEYTTSIPNPIIDHTP 174 KKGYKCF P+TK+ + TMDV+F+E++P+++K L GE + E WE +P+ I+D + Sbjct: 436 KKGYKCFNPLTKRFYTTMDVSFMENVPYFTKNLLQGEKLVEPNFWEIVEPLPSVILDISL 495 Query: 175 HSISDARTSVPTTSE 219 + + + PT SE Sbjct: 496 E--KENKETKPTESE 508 >emb|CAN76591.1| hypothetical protein VITISV_020293 [Vitis vinifera] Length = 1416 Score = 60.8 bits (146), Expect = 1e-07 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 2/76 (2%) Frame = +1 Query: 1 KKGYKCFYPVTKKLFITMDVTFVESMPFYSKPSL*GENMGES--WEYTTSIPNPIIDHTP 174 KKGYKCF P+TK+ + TMDV F+E++P+++K L GE + E WE +P+ I+D + Sbjct: 827 KKGYKCFNPLTKRFYTTMDVFFMENVPYFTKNLLQGEKLVEPNFWEIVEPLPSVILDISL 886 Query: 175 HSISDARTSVPTTSES 222 + + + PT S+S Sbjct: 887 E--KENKETKPTESKS 900