BLASTX nr result
ID: Atractylodes22_contig00037212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037212 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633118.1| PREDICTED: uncharacterized protein LOC100853... 63 3e-08 ref|XP_002514222.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_003633118.1| PREDICTED: uncharacterized protein LOC100853124 [Vitis vinifera] gi|297738749|emb|CBI27994.3| unnamed protein product [Vitis vinifera] Length = 95 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -1 Query: 466 AKNHAVAQAQQDGSKANFRIFDSPFGNFLVPVVPTRAE 353 A+ HAVAQAQQ+G ANF+IFDS FGNFL+PV+PT AE Sbjct: 55 ARRHAVAQAQQEGCTANFKIFDSRFGNFLLPVIPTHAE 92 >ref|XP_002514222.1| conserved hypothetical protein [Ricinus communis] gi|223546678|gb|EEF48176.1| conserved hypothetical protein [Ricinus communis] Length = 88 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -1 Query: 466 AKNHAVAQAQQDGSKANFRIFDSPFGNFLVPVVPTRAE 353 AK AVAQAQQ+G NF+I DSPF NFLVPV+PTRAE Sbjct: 48 AKEFAVAQAQQEGCTGNFKILDSPFENFLVPVIPTRAE 85