BLASTX nr result
ID: Atractylodes22_contig00037024
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Atractylodes22_contig00037024 (372 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519032.1| double-stranded RNA binding protein, putativ... 40 4e-07 ref|XP_003545893.1| PREDICTED: RNA polymerase II C-terminal doma... 39 5e-06 ref|XP_003529311.1| PREDICTED: RNA polymerase II C-terminal doma... 39 8e-06 >ref|XP_002519032.1| double-stranded RNA binding protein, putative [Ricinus communis] gi|223541695|gb|EEF43243.1| double-stranded RNA binding protein, putative [Ricinus communis] Length = 978 Score = 39.7 bits (91), Expect(2) = 4e-07 Identities = 29/68 (42%), Positives = 38/68 (55%) Frame = -3 Query: 316 YSTSEQSSTPAAMPIVPPTIPKPMVQYPTKQLPFATGNPVLQPLTQVNITETSLYYYYLA 137 Y+ + SS P PT +V +P+ QLP A P+++PL QV +E SL A Sbjct: 502 YTMASSSSIPV------PTSQPAVVTFPSMQLPQAA--PLVKPLGQVVPSEPSLQSSP-A 552 Query: 136 REEGEVPE 113 REEGEVPE Sbjct: 553 REEGEVPE 560 Score = 39.3 bits (90), Expect(2) = 4e-07 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -1 Query: 114 KVPESELDRYTRRRFLILQHGMDI 43 +VPESELD TRRR LILQHG D+ Sbjct: 557 EVPESELDPDTRRRLLILQHGQDL 580 >ref|XP_003545893.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 1-like [Glycine max] Length = 958 Score = 38.5 bits (88), Expect(2) = 5e-06 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 114 KVPESELDRYTRRRFLILQHGMD 46 +VPESELD TRRR LILQHG D Sbjct: 538 EVPESELDLDTRRRLLILQHGQD 560 Score = 36.6 bits (83), Expect(2) = 5e-06 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 3/89 (3%) Frame = -3 Query: 370 AMVSSTTPPMMPRQIQD---LYSTSEQSSTPAAMPIVPPTIPKPMVQYPTKQLPFATGNP 200 A+ +S+T P M + S+ + + ++ + PPT +VQ+ Q P N Sbjct: 456 AISASSTVPAMTTNLDPRLAFNSSLQYTMVSSSGTVPPPTAQASIVQFGNVQFP--QPNT 513 Query: 199 VLQPLTQVNITETSLYYYYLAREEGEVPE 113 +++P+ QV SL+ AREEGEVPE Sbjct: 514 LVKPICQVTPPGPSLHSSP-AREEGEVPE 541 >ref|XP_003529311.1| PREDICTED: RNA polymerase II C-terminal domain phosphatase-like 1-like [Glycine max] Length = 954 Score = 38.5 bits (88), Expect(2) = 8e-06 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -1 Query: 114 KVPESELDRYTRRRFLILQHGMD 46 +VPESELD TRRR LILQHG D Sbjct: 533 EVPESELDPDTRRRLLILQHGQD 555 Score = 35.8 bits (81), Expect(2) = 8e-06 Identities = 25/86 (29%), Positives = 45/86 (52%) Frame = -3 Query: 370 AMVSSTTPPMMPRQIQDLYSTSEQSSTPAAMPIVPPTIPKPMVQYPTKQLPFATGNPVLQ 191 A+ +++T P+ + ++ + + P+ + PPT M+ +P Q P +++ Sbjct: 455 ALSAASTIPVTTANLDPRLTSLQYTMVPSGS-VPPPTAQASMMPFPHVQFPQPA--TLVK 511 Query: 190 PLTQVNITETSLYYYYLAREEGEVPE 113 P+ Q +E SL+ AREEGEVPE Sbjct: 512 PMGQAAPSEPSLHSSP-AREEGEVPE 536